PDB entry 1ewx

View 1ewx on RCSB PDB site
Description: Crystal structure of native tryparedoxin I from Crithidia fasciculata
Deposited on 2000-04-28, released 2000-05-10
The last revision prior to the SCOP 1.55 freeze date was dated 2000-06-28, with a file datestamp of 2000-06-28.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.168
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1ewxa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ewxA (A:)
    sgldkylpgieklrrgdgevevkslagklvffyfsaswcppcrgftpqliefydkfhesk
    nfevvfctwdeeedgfagyfakmpwlavpfaqseavqklskhfnvesiptligvdadsgd
    vvttraratlvkdpegeqfpwkda