PDB entry 1ewx

View 1ewx on RCSB PDB site
Description: Crystal structure of native tryparedoxin I from Crithidia fasciculata
Class: electron transport
Keywords: electron transport
Deposited on 2000-04-28, released 2000-05-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.168
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tryparedoxin I
    Species: Crithidia fasciculata [TaxId:5656]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ewxa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ewxA (A:)
    sgldkylpgieklrrgdgevevkslagklvffyfsaswcppcrgftpqliefydkfhesk
    nfevvfctwdeeedgfagyfakmpwlavpfaqseavqklskhfnvesiptligvdadsgd
    vvttraratlvkdpegeqfpwkdap
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ewxA (A:)
    sgldkylpgieklrrgdgevevkslagklvffyfsaswcppcrgftpqliefydkfhesk
    nfevvfctwdeeedgfagyfakmpwlavpfaqseavqklskhfnvesiptligvdadsgd
    vvttraratlvkdpegeqfpwkda