PDB entry 1eww

View 1eww on RCSB PDB site
Description: solution structure of spruce budworm antifreeze protein at 30 degrees celsius
Class: antifreeze protein
Keywords: beta-helix, antifreeze protein, ice, insect
Deposited on 2000-04-27, released 2000-07-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: antifreeze protein
    Species: Choristoneura fumiferana [TaxId:7141]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ewwa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ewwA (A:)
    dgsctntnsqlsanskcekstltncyvdksevygttctgsrfdgvtittststgsrisgp
    gckistciitggvpapsaackisgctfsan