PDB entry 1ews

View 1ews on RCSB PDB site
Description: the three-dimensional solution structure of the rabbit kidney defensin, rk-1
Class: antimicrobial protein
Keywords: alpha defensin, triple-stranded beta-sheet, ANTIMICROBIAL PROTEIN
Deposited on 2000-04-26, released 2001-05-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: rk-1 defensin
  Species: Oryctolagus cuniculus [TaxId:9986]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P81655 (0-31)
  Domains in SCOPe 2.08: d1ewsa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ewsA (A:)
  mpcsckkycdpwevidgscglfnskyiccrek