PDB entry 1ewr

View 1ewr on RCSB PDB site
Description: crystal structure of taq muts
Deposited on 2000-04-26, released 2000-10-23
The last revision prior to the SCOP 1.67 freeze date was dated 2000-10-23, with a file datestamp of 2000-10-23.
Experiment type: XRAY
Resolution: 3.19 Å
R-factor: 0.331
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ewrA (A:)
    tpgtllqesllpreanylaaiatgdgwglafldvstgefkgtvlksksalydelfrhrpa
    evllapellengafldefrkrfpvmlseapfepegegplalrrargallayaqrtqggal
    slqpfrfydpgafmrlpeatlralevfeplrgqdtlfsvldetrtapgrrllqswlrhpl
    ldrgplearldrvegfvregalregvrrllyrladlerlatrlelgraspkdlgalrrsl
    qilpelrallgeevglpdlsplkeeleaalvedpplkvseggliregydpdldalraahr
    egvayfleleererertgiptlkvgynavfgyylevtrpyyervpkeyrpvqtlkdrqry
    tlpemkekerevyrlealirrreeevflevrerakrqaealreaarilaeldvyaalaev
    avrygyvrprfgdrlqiragrhpvverrtefvpndlemahelvlitgpnmagkstflrqt
    aliallaqvgsfvpaeeahlplfdgiytrigasddlaggkstfmvemeevalilkeaten
    slvlldevgrgtssldgvaiatavaealherraytlfathyfeltalglprlknlhvaar
    eeagglvfyhqvlpgpasksygvevaamaglpkevvararallqamaar
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ewrA (A:)
    anylaaiatgdgwglafldvstgefkgtvlksksalydelfrhrpaevllapellengaf
    ldefrkrseapfepegegplalrrargallayaqrtqggalslqpfrfydpgafmrlpea
    tlralevfeplrgqdtlfsvldetrtapgrrllqswlrhplldrgplearldrvegfvre
    galregvrrllyelgraspkdlgalreaarilaeldvyaalaevavrygyvrprfgdrlq
    iragrhpvverrtefvpndlemahelvlitgpnmagkstflrqtaliallaqvgsfvpae
    eahlplfdgiytrigagkstfmvemeevalilkeatenslvlldevgrgtssldgvaiat
    avaealherraytlfathyfeltalglprlknlhvaareeagglvfyhqvlpgpasksyg
    vevaamaglpkevvararallqamaar
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ewrB (B:)
    tpgtllqesllpreanylaaiatgdgwglafldvstgefkgtvlksksalydelfrhrpa
    evllapellengafldefrkrfpvmlseapfepegegplalrrargallayaqrtqggal
    slqpfrfydpgafmrlpeatlralevfeplrgqdtlfsvldetrtapgrrllqswlrhpl
    ldrgplearldrvegfvregalregvrrllyrladlerlatrlelgraspkdlgalrrsl
    qilpelrallgeevglpdlsplkeeleaalvedpplkvseggliregydpdldalraahr
    egvayfleleererertgiptlkvgynavfgyylevtrpyyervpkeyrpvqtlkdrqry
    tlpemkekerevyrlealirrreeevflevrerakrqaealreaarilaeldvyaalaev
    avrygyvrprfgdrlqiragrhpvverrtefvpndlemahelvlitgpnmagkstflrqt
    aliallaqvgsfvpaeeahlplfdgiytrigasddlaggkstfmvemeevalilkeaten
    slvlldevgrgtssldgvaiatavaealherraytlfathyfeltalglprlknlhvaar
    eeagglvfyhqvlpgpasksygvevaamaglpkevvararallqamaar
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ewrB (B:)
    tpgtllqesllpreanylaaiatgdgwglafldvstgefkgtvlksksalydelfrhrpa
    evllapellengafldefrklseapfepegegplalrrargallayaqrtqggalslqpf
    rfydpgafmrlpeatlralevfeplrgqdtlfsvldetrtapgrrllqswlrhplldrgp
    learldrvegfvregalregvrrllyrladlerlatrlelgraspkdlgalrrslqilpe
    lrallgeevglpdlsplkeeleaalvedppreeevflevrerakrqaealreaarilael
    dvyaalaevavrygyvrprfgdrlqiragrhpvverrtefvpndlemahelvlitgpnma
    gkstflrqtaliallaqvgsfvpaeeahlplfdgiytrigagkstfmvemeevalilkea
    tenslvlldevgrgtssldgvaiatavaealherraytlfathyfeltalglprlknlhv
    aareeagglvfyhqvlpgpasksygvevaamaglpkevvararallqam