PDB entry 1ewq

View 1ewq on RCSB PDB site
Description: crystal structure taq muts complexed with a heteroduplex dna at 2.2 a resolution
Deposited on 2000-04-26, released 2000-10-23
The last revision prior to the SCOP 1.69 freeze date was dated 2000-10-23, with a file datestamp of 2000-10-23.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.227
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ewqA (A:)
    megmlkgegpgplppllqqyvelrdqypdylllfqvgdfyecfgedaerlaralglvlth
    ktskdfttpmagiplrafeayaerllkmgfrlavadqvepaeeaeglvrrevtqlltpgt
    llqesllpreanylaaiatgdgwglafldvstgefkgtvlksksalydelfrhrpaevll
    apellengafldefrkrfpvmlseapfepegegplalrrargallayaqrtqggalslqp
    frfydpgafmrlpeatlralevfeplrgqdtlfsvldetrtapgrrllqswlrhplldrg
    plearldrvegfvregalregvrrllyrladlerlatrlelgraspkdlgalrrslqilp
    elrallgeevglpdlsplkeeleaalvedpplkvseggliregydpdldalraahregva
    yfleleererertgiptlkvgynavfgyylevtrpyyervpkeyrpvqtlkdrqrytlpe
    mkekerevyrlealirrreeevflevrerakrqaealreaarilaeldvyaalaevavry
    gyvrprfgdrlqiragrhpvverrtefvpndlemahelvlitgpnmagkstflrqtalia
    llaqvgsfvpaeeahlplfdgiytrigasddlaggkstfmvemeevalilkeatenslvl
    ldevgrgtssldgvaiatavaealherraytlfathyfeltalglprlknlhvaareeag
    glvfyhqvlpgpasksygvevaamaglpkevvararallqamaar
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ewqA (A:)
    megmlkgegpgplppllqqyvelrdqypdylllfqvgdfyecfgedaerlaralglvlth
    ktskdfttpmagiplrafeayaerllkmgfrlavadqvepaeeaeglvrrevtqlltpgt
    llqesllpreanylaaiatgdgwglafldvstgefkgtvlksksalydelfrhrpaevll
    apellengafldefrkrfpvmlseapfepegegplalrrargallayaqrtqggalslqp
    frfydpgafmrlpeatlralevfeplrgqdtlfsvldetrtapgrrllqswlrhplldrg
    plearldrvegfvregalregvrrllyrladlerlatrlelgraspkdlgalrrslqilp
    elrallgeevglpdlsplkeeleaalvedpplkvseggliregydpdldalraahregva
    yfleleererertgiptlkvgynavfgyylevtrpyyervpkeyrpvqtlkdrqrytlpe
    mkekerevyrlealirrreeevflevrerakrqaealreaarilaeldvyaalaevavry
    gyvrprfgdrlqiragrhpvverrtefvpndlemahelvlitgpnmagkstflrqtalia
    llaqvgsfvpaeeahlplfdgiytrigagkstfmvemeevalilkeatenslvlldevgr
    gtssldgvaiatavaealherraytlfathyfeltalglprlknlhvaareeagglvfyh
    qvlpgpasksygvevaamaglpkevvararallqamaar
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ewqB (B:)
    megmlkgegpgplppllqqyvelrdqypdylllfqvgdfyecfgedaerlaralglvlth
    ktskdfttpmagiplrafeayaerllkmgfrlavadqvepaeeaeglvrrevtqlltpgt
    llqesllpreanylaaiatgdgwglafldvstgefkgtvlksksalydelfrhrpaevll
    apellengafldefrkrfpvmlseapfepegegplalrrargallayaqrtqggalslqp
    frfydpgafmrlpeatlralevfeplrgqdtlfsvldetrtapgrrllqswlrhplldrg
    plearldrvegfvregalregvrrllyrladlerlatrlelgraspkdlgalrrslqilp
    elrallgeevglpdlsplkeeleaalvedpplkvseggliregydpdldalraahregva
    yfleleererertgiptlkvgynavfgyylevtrpyyervpkeyrpvqtlkdrqrytlpe
    mkekerevyrlealirrreeevflevrerakrqaealreaarilaeldvyaalaevavry
    gyvrprfgdrlqiragrhpvverrtefvpndlemahelvlitgpnmagkstflrqtalia
    llaqvgsfvpaeeahlplfdgiytrigasddlaggkstfmvemeevalilkeatenslvl
    ldevgrgtssldgvaiatavaealherraytlfathyfeltalglprlknlhvaareeag
    glvfyhqvlpgpasksygvevaamaglpkevvararallqamaar
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ewqB (B:)
    megmlkgegpgplppllqqyvelrdqypdylllfqvgdfyecfgedaerlaralglvlth
    ktskdfttpmagiplrafeayaerllkmgfrlavadqvepvrrevtqlltpgtllqesll
    preanylaaiatgdgwglafldvstgefkgtvlksksalydelfrhrpaevllapellen
    gafldefrkrfpvmlseapfepegegplalrrargallayaqrtqggalslqpfrfydpg
    afmrlpeatlralevfeplrgqdtlfsvldetrtapgrrllqswlrhplldrgplearld
    rvegfvregalregvrrllyrladlerlatrlelgraspkdlgalrrslqilpelrallg
    eevglpdlsplkeeleaalvedpplkvseggliregydpdldalraahregvayflelee
    rerertgiptlkvgynavfgyylevtrpyyervpkeyrpvqtlkdrqrytlpemkekere
    vyrlealirrreeevflevrerakrqaealreaarilaeldvyaalaevavrygyvrprf
    gdrlqiragrhpvverrtefvpndlemahelvlitgpnmagkstflrqtaliallaqvgs
    fvpaeeahlplfdgiytrigagkstfmvemeevalilkeatenslvlldevgrgtssldg
    vaiatavaealherraytlfathyfeltalglprlknlhvaareeagglvfyhqvlpgpa
    sksygvevaamaglpkevvararallqam