PDB entry 1ewo

View 1ewo on RCSB PDB site
Description: the cysteine protease cruzain bound to wrr-204
Class: hydrolase/hydrolase inhibitor
Keywords: cysteine protease, drug design, covalent inhibitor, cruzipain, HYDROLASE-HYDROLASE INHIBITOR COMPLEX
Deposited on 2000-04-26, released 2003-06-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.221
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cruzain
  Species: Trypanosoma cruzi [TaxId:5693]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P25779 (0-214)
  Domains in SCOPe 2.08: d1ewoa_
• Heterogens: VSC, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ewoA (A:)
  apaavdwrargavtavkdqgqcgscwafsaignvecqwflaghpltnlseqmlvscdktd
  sgcsgglmnnafewivqenngavytedsypyasgegisppcttsghtvgatitghvelpq
  deaqiaawlavngpvavavdasswmtytggvmtscvseqldhgvllvgyndsaavpywii
  knswttqwgeegyiriakgsnqclvkeeassavvg