PDB entry 1ewm

View 1ewm on RCSB PDB site
Description: the cysteine protease cruzain bound to wrr-112
Class: hydrolase/hydrolase inhibitor
Keywords: cruzain, cruzipain, drug design, covalent inhibitor, cysteine protease, HYDROLASE-HYDROLASE INHIBITOR COMPLEX
Deposited on 2000-04-26, released 2003-06-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.173
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cruzain
  Species: Trypanosoma cruzi [TaxId:5693]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P25779 (0-214)
  Domains in SCOPe 2.08: d1ewma_
• Heterogens: RL2, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ewmA (A:)
  apaavdwrargavtavkdqgqcgscwafsaignvecqwflaghpltnlseqmlvscdktd
  sgcsgglmnnafewivqenngavytedsypyasgegisppcttsghtvgatitghvelpq
  deaqiaawlavngpvavavdasswmtytggvmtscvseqldhgvllvgyndsaavpywii
  knswttqwgeegyiriakgsnqclvkeeassavvg