PDB entry 1ewl

View 1ewl on RCSB PDB site
Description: crystal structure of cruzain bound to wrr-99
Class: hydrolase/hydrolase inhibitor
Keywords: papain-like cysteine protease, drug design, covalent inhibitor, cruzipain, HYDROLASE-HYDROLASE INHIBITOR COMPLEX
Deposited on 2000-04-26, released 2003-06-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.171
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cruzain
    Species: Trypanosoma cruzi [TaxId:5693]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ewla_
  • Heterogens: R99, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ewlA (A:)
    apaavdwrargavtavkdqgqcgscwafsaignvecqwflaghpltnlseqmlvscdktd
    sgcsgglmnnafewivqenngavytedsypyasgegisppcttsghtvgatitghvelpq
    deaqiaawlavngpvavavdasswmtytggvmtscvseqldhgvllvgyndsaavpywii
    knswttqwgeegyiriakgsnqclvkeeassavvg