PDB entry 1ewk

View 1ewk on RCSB PDB site
Description: crystal structure of metabotropic glutamate receptor subtype 1 complexed with glutamate
Class: signaling protein
Keywords: signal transduction, neurotransmitter, cns, neuron, signaling protein
Deposited on 2000-04-26, released 2000-12-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.196
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: metabotropic glutamate receptor subtype 1
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ewka_
  • Chain 'B':
    Compound: metabotropic glutamate receptor subtype 1
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ewkb_
  • Heterogens: NAG, MG, GLU, EPE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ewkA (A:)
    ssqrsvarmdgdviigalfsvhhqppaekvperkcgeireqygiqrveamfhtldkinad
    pvllpnitlgseirdscwhssvaleqsiefirdslisirdekdglnrclpdgqtlppgrt
    kkpiagvigpgsssvaiqvqnllqlfdipqiaysatsidlsdktlykyflrvvpsdtlqa
    ramldivkrynwtyvsavhtegnygesgmdafkelaaqeglciahsdkiysnageksfdr
    llrklrerlpkarvvvcfcegmtvrgllsamrrlgvvgefsligsdgwadrdeviegyev
    eanggitiklqspevrsfddyflklrldtntrnpwfpefwqhrfqcrlpghllenpnfkk
    vctgnesleenyvqdskmgfvinaiyamahglqnmhhalcpghvglcdamkpidgrklld
    flikssfvgvsgeevwfdekgdapgrydimnlqyteanrydyvhvgtwhegvlniddyki
    qmnksgmvrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ewkA (A:)
    rsvarmdgdviigalfsvhhqppaekvperkcgeireqygiqrveamfhtldkinadpvl
    lpnitlgseirdscwhssvaleqsiefirkpiagvigpgsssvaiqvqnllqlfdipqia
    ysatsidlsdktlykyflrvvpsdtlqaramldivkrynwtyvsavhtegnygesgmdaf
    kelaaqeglciahsdkiysnageksfdrllrklrerlpkarvvvcfcegmtvrgllsamr
    rlgvvgefsligsdgwadrdeviegyeveanggitiklqspevrsfddyflklrldtntr
    npwfpefwqhrfqcrlpghllenpnfkkvctgnesleenyvqdskmgfvinaiyamahgl
    qnmhhalcpghvglcdamkpidgrklldflikssfvgvsgeevwfdekgdapgrydimnl
    qyteanrydyvhvgtwhegvlniddyki
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ewkB (B:)
    ssqrsvarmdgdviigalfsvhhqppaekvperkcgeireqygiqrveamfhtldkinad
    pvllpnitlgseirdscwhssvaleqsiefirdslisirdekdglnrclpdgqtlppgrt
    kkpiagvigpgsssvaiqvqnllqlfdipqiaysatsidlsdktlykyflrvvpsdtlqa
    ramldivkrynwtyvsavhtegnygesgmdafkelaaqeglciahsdkiysnageksfdr
    llrklrerlpkarvvvcfcegmtvrgllsamrrlgvvgefsligsdgwadrdeviegyev
    eanggitiklqspevrsfddyflklrldtntrnpwfpefwqhrfqcrlpghllenpnfkk
    vctgnesleenyvqdskmgfvinaiyamahglqnmhhalcpghvglcdamkpidgrklld
    flikssfvgvsgeevwfdekgdapgrydimnlqyteanrydyvhvgtwhegvlniddyki
    qmnksgmvrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ewkB (B:)
    qrsvarmdgdviigalfsvhhqppaekvperkcgeireqygiqrveamfhtldkinadpv
    llpnitlgseirdscwhssvaleqsiefirkpiagvigpgsssvaiqvqnllqlfdipqi
    aysatsidlsdktlykyflrvvpsdtlqaramldivkrynwtyvsavhtegnygesgmda
    fkelaaqeglciahsdkiysnageksfdrllrklrerlpkarvvvcfcegmtvrgllsam
    rrlgvvgefsligsdgwadrdeviegyeveanggitiklqspevrsfddyflklrldtnt
    rnpwfpefwqhrfqcrlpghllenpnfkkvctgnesleenyvqdskmgfvinaiyamahg
    lqnmhhalcpghvglcdamkpidgrklldflikssfvgvsgeevwfdekgdapgrydimn
    lqyteanrydyvhvgtwhegvlniddyki