PDB entry 1ewj

View 1ewj on RCSB PDB site
Description: crystal structure of bleomycin-binding protein complexed with bleomycin
Class: antibiotic inhibitor
Keywords: bleomycin-binding protein, bleomycin, antibiotics resistance, homodimer, ANTIBIOTIC INHIBITOR
Deposited on 2000-04-26, released 2001-04-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bleomycin resistance determinant
    Species: Klebsiella pneumoniae [TaxId:573]
    Gene: TRANSPOSON TN5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ewja_
  • Chain 'B':
    Compound: bleomycin resistance determinant
    Species: Klebsiella pneumoniae [TaxId:573]
    Gene: TRANSPOSON TN5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ewjb_
  • Chain 'C':
    Compound: bleomycin resistance determinant
    Species: Klebsiella pneumoniae [TaxId:573]
    Gene: TRANSPOSON TN5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ewjc_
  • Chain 'D':
    Compound: bleomycin resistance determinant
    Species: Klebsiella pneumoniae [TaxId:573]
    Gene: TRANSPOSON TN5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ewjd_
  • Chain 'E':
    Compound: bleomycin resistance determinant
    Species: Klebsiella pneumoniae [TaxId:573]
    Gene: TRANSPOSON TN5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ewje_
  • Chain 'F':
    Compound: bleomycin resistance determinant
    Species: Klebsiella pneumoniae [TaxId:573]
    Gene: TRANSPOSON TN5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ewjf_
  • Chain 'G':
    Compound: bleomycin resistance determinant
    Species: Klebsiella pneumoniae [TaxId:573]
    Gene: TRANSPOSON TN5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ewjg_
  • Chain 'H':
    Compound: bleomycin resistance determinant
    Species: Klebsiella pneumoniae [TaxId:573]
    Gene: TRANSPOSON TN5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ewjh_
  • Heterogens: BLM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ewjA (A:)
    mtdqatpnlpsrdfdstaafyerlgfgivfrdagwmilqrgdlmleffahpgldplaswf
    scclrlddlaefyrqcksvgiqetssgyprihapelqewggtmaalvdpdgtllrliqne
    llagis
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ewjA (A:)
    tdqatpnlpsrdfdstaafyerlgfgivfrdagwmilqrgdlmleffahpgldplaswfs
    cclrlddlaefyrqcksvgiqetssgyprihapelqewggtmaalvdpdgtllrliqne
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ewjB (B:)
    mtdqatpnlpsrdfdstaafyerlgfgivfrdagwmilqrgdlmleffahpgldplaswf
    scclrlddlaefyrqcksvgiqetssgyprihapelqewggtmaalvdpdgtllrliqne
    llagis
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ewjB (B:)
    tdqatpnlpsrdfdstaafyerlgfgivfrdagwmilqrgdlmleffahpgldplaswfs
    cclrlddlaefyrqcksvgiqetssgyprihapelqewggtmaalvdpdgtllrliqne
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ewjC (C:)
    mtdqatpnlpsrdfdstaafyerlgfgivfrdagwmilqrgdlmleffahpgldplaswf
    scclrlddlaefyrqcksvgiqetssgyprihapelqewggtmaalvdpdgtllrliqne
    llagis
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ewjC (C:)
    tdqatpnlpsrdfdstaafyerlgfgivfrdagwmilqrgdlmleffahpgldplaswfs
    cclrlddlaefyrqcksvgiqetssgyprihapelqewggtmaalvdpdgtllrliqne
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ewjD (D:)
    mtdqatpnlpsrdfdstaafyerlgfgivfrdagwmilqrgdlmleffahpgldplaswf
    scclrlddlaefyrqcksvgiqetssgyprihapelqewggtmaalvdpdgtllrliqne
    llagis
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ewjD (D:)
    tdqatpnlpsrdfdstaafyerlgfgivfrdagwmilqrgdlmleffahpgldplaswfs
    cclrlddlaefyrqcksvgiqetssgyprihapelqewggtmaalvdpdgtllrliqne
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1ewjE (E:)
    mtdqatpnlpsrdfdstaafyerlgfgivfrdagwmilqrgdlmleffahpgldplaswf
    scclrlddlaefyrqcksvgiqetssgyprihapelqewggtmaalvdpdgtllrliqne
    llagis
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ewjE (E:)
    tdqatpnlpsrdfdstaafyerlgfgivfrdagwmilqrgdlmleffahpgldplaswfs
    cclrlddlaefyrqcksvgiqetssgyprihapelqewggtmaalvdpdgtllrliqne
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1ewjF (F:)
    mtdqatpnlpsrdfdstaafyerlgfgivfrdagwmilqrgdlmleffahpgldplaswf
    scclrlddlaefyrqcksvgiqetssgyprihapelqewggtmaalvdpdgtllrliqne
    llagis
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ewjF (F:)
    tdqatpnlpsrdfdstaafyerlgfgivfrdagwmilqrgdlmleffahpgldplaswfs
    cclrlddlaefyrqcksvgiqetssgyprihapelqewggtmaalvdpdgtllrliqne
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1ewjG (G:)
    mtdqatpnlpsrdfdstaafyerlgfgivfrdagwmilqrgdlmleffahpgldplaswf
    scclrlddlaefyrqcksvgiqetssgyprihapelqewggtmaalvdpdgtllrliqne
    llagis
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ewjG (G:)
    tdqatpnlpsrdfdstaafyerlgfgivfrdagwmilqrgdlmleffahpgldplaswfs
    cclrlddlaefyrqcksvgiqetssgyprihapelqewggtmaalvdpdgtllrliqne
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1ewjH (H:)
    mtdqatpnlpsrdfdstaafyerlgfgivfrdagwmilqrgdlmleffahpgldplaswf
    scclrlddlaefyrqcksvgiqetssgyprihapelqewggtmaalvdpdgtllrliqne
    llagis
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ewjH (H:)
    tdqatpnlpsrdfdstaafyerlgfgivfrdagwmilqrgdlmleffahpgldplaswfs
    cclrlddlaefyrqcksvgiqetssgyprihapelqewggtmaalvdpdgtllrliqne