PDB entry 1ewi

View 1ewi on RCSB PDB site
Description: human replication protein a: global fold of the n-terminal rpa-70 domain reveals a basic cleft and flexible c-terminal linker
Deposited on 2000-04-25, released 2000-05-10
The last revision prior to the SCOP 1.57 freeze date was dated 2000-05-10, with a file datestamp of 2000-05-10.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1ewia_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ewiA (A:)
    mvgqlsegaiaaimqkgdtnikpilqvinirpittgnsppryrllmsdglntlssfmlat
    qlnplveeeqlssncvcqihrfivntlkdgrrvvilmelevlksaeavgvkign