PDB entry 1ewg

View 1ewg on RCSB PDB site
Description: fructose 1,6-bisphosphate aldolase from rabbit muscle
Class: lyase
Keywords: aldolase, lyase(aldehyde), schiff base, glycolysis
Deposited on 2000-04-25, released 2001-01-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2007-11-13, with a file datestamp of 2007-11-09.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.189
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fructose 1,6-bisphosphate aldolase
    Species: Oryctolagus cuniculus
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00883 (0-362)
      • engineered (186)
    Domains in SCOPe 2.07: d1ewga_
  • Chain 'B':
    Compound: fructose 1,6-bisphosphate aldolase
    Species: Oryctolagus cuniculus
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00883 (0-362)
      • engineered (186)
    Domains in SCOPe 2.07: d1ewgb_
  • Chain 'C':
    Compound: fructose 1,6-bisphosphate aldolase
    Species: Oryctolagus cuniculus
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00883 (0-362)
      • engineered (186)
    Domains in SCOPe 2.07: d1ewgc_
  • Chain 'D':
    Compound: fructose 1,6-bisphosphate aldolase
    Species: Oryctolagus cuniculus
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00883 (0-362)
      • engineered (186)
    Domains in SCOPe 2.07: d1ewgd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ewgA (A:)
    phshpaltpeqkkelsdiahrivapgkgilaadestgsiakrlqsigtenteenrrfyrq
    llltaddrvnpciggvilfhetlyqkaddgrpfpqvikskggvvgikvdkgvvplagtng
    etttqgldglsercaqykkdgadfakwrcvlkigehtpsalaimenanvlaryasicqqn
    givpivqpeilpdgdhdlkrcqyvtekvlaavykalsdhhiylegtllkpnmvtpghact
    qkysheeiamatvtalrrtvppavtgvtflsggqseeeasinlnainkcpllkpwaltfs
    ygralqasalkawggkkenlkaaqeeyvkralanslacqgkytpsgqagaaaseslfisn
    hay
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ewgB (B:)
    phshpaltpeqkkelsdiahrivapgkgilaadestgsiakrlqsigtenteenrrfyrq
    llltaddrvnpciggvilfhetlyqkaddgrpfpqvikskggvvgikvdkgvvplagtng
    etttqgldglsercaqykkdgadfakwrcvlkigehtpsalaimenanvlaryasicqqn
    givpivqpeilpdgdhdlkrcqyvtekvlaavykalsdhhiylegtllkpnmvtpghact
    qkysheeiamatvtalrrtvppavtgvtflsggqseeeasinlnainkcpllkpwaltfs
    ygralqasalkawggkkenlkaaqeeyvkralanslacqgkytpsgqagaaaseslfisn
    hay
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ewgC (C:)
    phshpaltpeqkkelsdiahrivapgkgilaadestgsiakrlqsigtenteenrrfyrq
    llltaddrvnpciggvilfhetlyqkaddgrpfpqvikskggvvgikvdkgvvplagtng
    etttqgldglsercaqykkdgadfakwrcvlkigehtpsalaimenanvlaryasicqqn
    givpivqpeilpdgdhdlkrcqyvtekvlaavykalsdhhiylegtllkpnmvtpghact
    qkysheeiamatvtalrrtvppavtgvtflsggqseeeasinlnainkcpllkpwaltfs
    ygralqasalkawggkkenlkaaqeeyvkralanslacqgkytpsgqagaaaseslfisn
    hay
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ewgD (D:)
    phshpaltpeqkkelsdiahrivapgkgilaadestgsiakrlqsigtenteenrrfyrq
    llltaddrvnpciggvilfhetlyqkaddgrpfpqvikskggvvgikvdkgvvplagtng
    etttqgldglsercaqykkdgadfakwrcvlkigehtpsalaimenanvlaryasicqqn
    givpivqpeilpdgdhdlkrcqyvtekvlaavykalsdhhiylegtllkpnmvtpghact
    qkysheeiamatvtalrrtvppavtgvtflsggqseeeasinlnainkcpllkpwaltfs
    ygralqasalkawggkkenlkaaqeeyvkralanslacqgkytpsgqagaaaseslfisn
    hay