PDB entry 1ewd

View 1ewd on RCSB PDB site
Description: fructose 1,6-bisphosphate aldolase from rabbit muscle
Deposited on 2000-04-25, released 2001-01-24
The last revision prior to the SCOP 1.55 freeze date was dated 2001-01-24, with a file datestamp of 2001-01-24.
Experiment type: XRAY
Resolution: 2.46 Å
R-factor: 0.17
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1ewda_
  • Chain 'B':
    Domains in SCOP 1.55: d1ewdb_
  • Chain 'C':
    Domains in SCOP 1.55: d1ewdc_
  • Chain 'D':
    Domains in SCOP 1.55: d1ewdd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ewdA (A:)
    phshpaltpeqkkelsdiahrivapgkgilaadestgsiakrlqsigtenteenrrfyrq
    llltaddrvnpciggvilfhetlyqkaddgrpfpqvikskggvvgimvdkgvvplagtng
    etttqgldglsercaqykkdgadfakwrcvlkigehtpsalaimenanvlaryasicqqn
    givpivepeilpdgdhdlkrcqyvtekvlaavykalsdhhiylegtllkpnmvtpghact
    qkysheeiamatvtalrrtvppavtgvtflsggqseeeasinlnainkcpllkpwaltfs
    ygralqasalkawggkkenlkaaqeeyvkralanslacqgkytssgqagaaaseslfisn
    hay
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ewdB (B:)
    phshpaltpeqkkelsdiahrivapgkgilaadestgsiakrlqsigtenteenrrfyrq
    llltaddrvnpciggvilfhetlyqkaddgrpfpqvikskggvvgimvdkgvvplagtng
    etttqgldglsercaqykkdgadfakwrcvlkigehtpsalaimenanvlaryasicqqn
    givpivepeilpdgdhdlkrcqyvtekvlaavykalsdhhiylegtllkpnmvtpghact
    qkysheeiamatvtalrrtvppavtgvtflsggqseeeasinlnainkcpllkpwaltfs
    ygralqasalkawggkkenlkaaqeeyvkralanslacqgkytssgqagaaaseslfisn
    hay
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ewdC (C:)
    phshpaltpeqkkelsdiahrivapgkgilaadestgsiakrlqsigtenteenrrfyrq
    llltaddrvnpciggvilfhetlyqkaddgrpfpqvikskggvvgimvdkgvvplagtng
    etttqgldglsercaqykkdgadfakwrcvlkigehtpsalaimenanvlaryasicqqn
    givpivepeilpdgdhdlkrcqyvtekvlaavykalsdhhiylegtllkpnmvtpghact
    qkysheeiamatvtalrrtvppavtgvtflsggqseeeasinlnainkcpllkpwaltfs
    ygralqasalkawggkkenlkaaqeeyvkralanslacqgkytssgqagaaaseslfisn
    hay
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ewdD (D:)
    phshpaltpeqkkelsdiahrivapgkgilaadestgsiakrlqsigtenteenrrfyrq
    llltaddrvnpciggvilfhetlyqkaddgrpfpqvikskggvvgimvdkgvvplagtng
    etttqgldglsercaqykkdgadfakwrcvlkigehtpsalaimenanvlaryasicqqn
    givpivepeilpdgdhdlkrcqyvtekvlaavykalsdhhiylegtllkpnmvtpghact
    qkysheeiamatvtalrrtvppavtgvtflsggqseeeasinlnainkcpllkpwaltfs
    ygralqasalkawggkkenlkaaqeeyvkralanslacqgkytssgqagaaaseslfisn
    hay