PDB entry 1ewc

View 1ewc on RCSB PDB site
Description: crystal structure of zn2+ loaded staphylococcal enterotoxin h
Class: toxin
Keywords: beta-barrel, beta-grasp, TOXIN
Deposited on 2000-04-25, released 2000-05-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: enterotoxin h
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A0M0 (0-213)
      • conflict (180)
    Domains in SCOPe 2.08: d1ewca1, d1ewca2
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ewcA (A:)
dlhdkseltdlalanaygqynhpfikeniksdeisgekdlifrnqgdsgndlrvkfatad
laqkfknknvdiygasfyykcekiseniseclyggttlnseklaqerviganvwvdgiqk
etelirtnkknvtlqeldikirkilsdkykiyykdseiskgliefdmktprdysfdiydl
ggendyeidkiyednktlksddishidvnlytkk