PDB entry 1ew6

View 1ew6 on RCSB PDB site
Description: the crystal structure and amino acid sequence of dehaloperoxidase from amphitrite ornata indicate common ancestry with globins
Deposited on 2000-04-24, released 2000-05-10
The last revision prior to the SCOP 1.71 freeze date was dated 2000-09-06, with a file datestamp of 2000-09-06.
Experiment type: XRAY
Resolution: 1.78 Å
R-factor: 0.197
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1ew6a_
  • Chain 'B':
    Domains in SCOP 1.71: d1ew6b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ew6A (A:)
    gfkqdiatirgdlrtyaqdiflaflnkypderryfknyvgksdqelksmakfgdhtekvf
    nlmmevadratdcvplasdantlvqmkqhsslttgnfeklfvalveymrasgqsfdsqsw
    drfgknlvsalssagmk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ew6B (B:)
    gfkqdiatirgdlrtyaqdiflaflnkypderryfknyvgksdqelksmakfgdhtekvf
    nlmmevadratdcvplasdantlvqmkqhsslttgnfeklfvalveymrasgqsfdsqsw
    drfgknlvsalssagmk