PDB entry 1ew6

View 1ew6 on RCSB PDB site
Description: the crystal structure and amino acid sequence of dehaloperoxidase from amphitrite ornata indicate common ancestry with globins
Class: oxidoreductase
Keywords: globin, halophenols, oxidoreductase
Deposited on 2000-04-24, released 2000-05-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.78 Å
R-factor: 0.197
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dehaloperoxidase
    Species: Amphitrite ornata [TaxId:129555]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ew6a_
  • Chain 'B':
    Compound: dehaloperoxidase
    Species: Amphitrite ornata [TaxId:129555]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ew6b_
  • Heterogens: SO4, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ew6A (A:)
    gfkqdiatirgdlrtyaqdiflaflnkypderryfknyvgksdqelksmakfgdhtekvf
    nlmmevadratdcvplasdantlvqmkqhsslttgnfeklfvalveymrasgqsfdsqsw
    drfgknlvsalssagmk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ew6B (B:)
    gfkqdiatirgdlrtyaqdiflaflnkypderryfknyvgksdqelksmakfgdhtekvf
    nlmmevadratdcvplasdantlvqmkqhsslttgnfeklfvalveymrasgqsfdsqsw
    drfgknlvsalssagmk