PDB entry 1ew4

View 1ew4 on RCSB PDB site
Description: crystal structure of escherichia coli cyay protein reveals a novel fold for the frataxin family
Class: unknown function
Keywords: Friedreich ataxia, frataxin family, CyaY, iron homeostasis, UNKNOWN FUNCTION
Deposited on 2000-04-22, released 2000-08-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.188
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cyay protein
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P27838 (0-105)
  Domains in SCOPe 2.08: d1ew4a_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ew4A (A:)
  mndsefhrladqlwltieerlddwdgdsdidceinggvltitfengskiiinrqeplhqv
  wlatkqggyhfdlkgdewicdrsgetfwdlleqaatqqagetvsfr