PDB entry 1ew3

View 1ew3 on RCSB PDB site
Description: crystal structure of the major horse allergen equ c 1
Class: allergen
Keywords: lipocalin, beta barrel, ALLERGEN
Deposited on 2000-04-21, released 2000-05-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.195
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: allergen equ c 1
    Species: Equus caballus [TaxId:9796]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ew3a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ew3A (A:)
    vairnfdiskisgewysiflasdvkekieengsmrvfvdviraldnsslyaeyqtkvnge
    ctefpmvfdkteedgvyslnydgynvfrisefendehiilylvnfdkdrpfqlfefyare
    pdvspeikeefvkivqkrgivkeniidltkidrcfqlrg