PDB entry 1ew2

View 1ew2 on RCSB PDB site
Description: crystal structure of a human phosphatase
Class: hydrolase
Keywords: phosphatase, non covalent complex, HYDROLASE
Deposited on 2000-04-21, released 2001-03-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.82 Å
R-factor: 0.185
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphatase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ew2a_
  • Heterogens: NAG, ZN, MG, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ew2A (A:)
    iipveeenpdfwnreaaealgaakklqpaqtaaknliiflgdgmgvstvtaarilkgqkk
    dklgpeiplamdrfpyvalsktynvdkhvpdsgatataylcgvkgnfqtiglsaaarfnq
    cnttrgnevisvmnrakkagksvgvvtttrvqhaspagtyahtvnrnwysdadvpasarq
    egcqdiatqlisnmdidvilgggrkymfrmgtpdpeypddysqggtrldgknlvqewlak
    rqgaryvwnrtelmqasldpsvthlmglfepgdmkyeihrdstldpslmemteaalrlls
    rnprgfflfveggridhghhesrayraltetimfddaieragqltseedtlslvtadhsh
    vfsfggyplrgssifglapgkardrkaytvllygngpgyvlkdgarpdvtesesgspeyr
    qqsavpldeethagedvavfargpqahlvhgvqeqtfiahvmafaaclepytacdlappa
    gttdaahpgrsvvpallpllagtlllletatap
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ew2A (A:)
    iipveeenpdfwnreaaealgaakklqpaqtaaknliiflgdgmgvstvtaarilkgqkk
    dklgpeiplamdrfpyvalsktynvdkhvpdsgatataylcgvkgnfqtiglsaaarfnq
    cnttrgnevisvmnrakkagksvgvvtttrvqhaspagtyahtvnrnwysdadvpasarq
    egcqdiatqlisnmdidvilgggrkymfrmgtpdpeypddysqggtrldgknlvqewlak
    rqgaryvwnrtelmqasldpsvthlmglfepgdmkyeihrdstldpslmemteaalrlls
    rnprgfflfveggridhghhesrayraltetimfddaieragqltseedtlslvtadhsh
    vfsfggyplrgssifglapgkardrkaytvllygngpgyvlkdgarpdvtesesgspeyr
    qqsavpldeethagedvavfargpqahlvhgvqeqtfiahvmafaaclepytacdlapp