PDB entry 1ew0

View 1ew0 on RCSB PDB site
Description: crystal structure analysis of the sensor domain of rmfixl(ferrous form)
Class: transferase
Keywords: oxygen sensor, heme protein, histidine kinase, rhizobium meliloti, transferase
Deposited on 2000-04-21, released 2000-05-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fixl
    Species: Sinorhizobium meliloti [TaxId:382]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10955 (0-129)
      • conflict (0-5)
    Domains in SCOPe 2.08: d1ew0a_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ew0A (A:)
    gshmletedvvrardahlrsildtvpdatvvsatdgtivsfnaaavrqfgyaeeevigqn
    lrilmpepyrhehdgylqrymatgekriigidrvvsgqrkdgstfpmklavgemrsgger
    fftgfirdlt