PDB entry 1evz

View 1evz on RCSB PDB site
Description: crystal structure of leishmania mexicana glycerol-3-phosphate dehydrogenase in complex with nad
Class: oxidoreductase
Keywords: Dehydrogenase, Rossmann fold, OXIDOREDUCTASE
Deposited on 2000-04-21, released 2001-02-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.183
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glycerol-3-phosphate dehydrogenase
    Species: Leishmania mexicana [TaxId:5665]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1evza1, d1evza2
  • Heterogens: NAD, MYS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1evzA (A:)
    mstkqhsakdellylnkavvfgsgafgtalamvlskkcrevcvwhmneeevrlvnekren
    vlflkgvqlasnitftsdvekayngaeiilfviptqflrgffeksggnliayakekqvpv
    lvctkgierstlkfpaeiigeflpspllsvlagpsfaievatgvftcvsiasadinvarr
    lqrimstgdrsfvcwattdtvgcevasavknvlaigsgvanglgmglnaraalimrglle
    irdltaalggdgsavfglaglgdlqltcsselsrnftvgkklgkglpieeiqrtskavae
    gvatadplmrlakqlkvkmplchqiyeivykkknprdaladllscglqdeglpplfkrsa
    stpskl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1evzA (A:)
    kdellylnkavvfgsgafgtalamvlskkcrevcvwhmneeevrlvnekrenvlflkgvq
    lasnitftsdvekayngaeiilfviptqflrgffeksggnliayakekqvpvlvctkgie
    rstlkfpaeiigeflpspllsvlagpsfaievatgvftcvsiasadinvarrlqrimstg
    drsfvcwattdtvgcevasavknvlaigsgvanglgmglnaraalimrglleirdltaal
    ggdgsavfglaglgdlqltcsselsrnftvgkklgkglpieeiqravaegvatadplmrl
    akqlkvkmplchqiyeivykkknprdaladllscglqdeglpplfk