PDB entry 1evx

View 1evx on RCSB PDB site
Description: apo crystal structure of the homing endonuclease, i-ppoi
Deposited on 2000-04-20, released 2000-08-02
The last revision prior to the SCOP 1.55 freeze date was dated 2000-08-02, with a file datestamp of 2000-08-02.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.194
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1evxa_
  • Chain 'B':
    Domains in SCOP 1.55: d1evxb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1evxA (A:)
    altnaqilavidsweetvgqfpvithhvplggglqgtlhcyeiplaapygvgfakngptr
    wqykrtinqvvhrwgshtvpfllepdningktctashlchntrchnplhlcweslddnkg
    rnwcpgpnggcvhavvclrqgplygpgatvagpqqrgshfvv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1evxB (B:)
    altnaqilavidsweetvgqfpvithhvplggglqgtlhcyeiplaapygvgfakngptr
    wqykrtinqvvhrwgshtvpfllepdningktctashlchntrchnplhlcweslddnkg
    rnwcpgpnggcvhavvclrqgplygpgatvagpqqrgshfvv