PDB entry 1evx

View 1evx on RCSB PDB site
Description: apo crystal structure of the homing endonuclease, I-ppoi
Class: hydrolase
Keywords: DNA binding B-sheets; C-terminal exchanged dimer interface, HYDROLASE
Deposited on 2000-04-20, released 2000-08-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-31, with a file datestamp of 2018-01-26.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: intron-encoded homing endonuclease I-ppoi
    Species: Physarum polycephalum [TaxId:5791]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1evxa_
  • Chain 'B':
    Compound: intron-encoded homing endonuclease I-ppoi
    Species: Physarum polycephalum [TaxId:5791]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1evxb_
  • Heterogens: ZN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1evxA (A:)
altnaqilavidsweetvgqfpvithhvplggglqgtlhcyeiplaapygvgfakngptr
wqykrtinqvvhrwgshtvpfllepdningktctashlchntrchnplhlcweslddnkg
rnwcpgpnggcvhavvclrqgplygpgatvagpqqrgshfvv

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1evxB (B:)
altnaqilavidsweetvgqfpvithhvplggglqgtlhcyeiplaapygvgfakngptr
wqykrtinqvvhrwgshtvpfllepdningktctashlchntrchnplhlcweslddnkg
rnwcpgpnggcvhavvclrqgplygpgatvagpqqrgshfvv