PDB entry 1evw

View 1evw on RCSB PDB site
Description: l116a mutant of the homing endonuclease I-ppoi complexed to homing site DNA.
Class: Hydrolase/DNA
Keywords: DNA binding B-sheets; C-terminal exchanged dimer interface; bent DNA, Hydrolase/DNA COMPLEX
Deposited on 2000-04-20, released 2000-08-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.273
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: I-ppoi homing endonuclease
    Species: Physarum polycephalum [TaxId:5791]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q94702 (Start-162)
      • engineered (115)
    Domains in SCOPe 2.07: d1evwa_
  • Chain 'B':
    Compound: I-ppoi homing endonuclease
    Species: Physarum polycephalum [TaxId:5791]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q94702 (Start-162)
      • engineered (115)
    Domains in SCOPe 2.07: d1evwb_
  • Chain 'C':
    Compound: I-ppoi homing endonuclease
    Species: Physarum polycephalum [TaxId:5791]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q94702 (Start-162)
      • engineered (115)
    Domains in SCOPe 2.07: d1evwc_
  • Chain 'D':
    Compound: I-ppoi homing endonuclease
    Species: Physarum polycephalum [TaxId:5791]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q94702 (Start-162)
      • engineered (115)
    Domains in SCOPe 2.07: d1evwd_
  • Chain 'E':
    Compound: DNA (5'-d(*tp*gp*gp*cp*tp*ap*cp*cp*tp*tp*ap*a)-3')
    Species: synthetic, synthetic
  • Chain 'F':
    Compound: DNA (5'-d(*tp*gp*ap*cp*tp*cp*tp*cp*tp*tp*ap*a)-3')
  • Chain 'G':
    Compound: DNA (5'-d(*tp*gp*gp*cp*tp*ap*cp*cp*tp*tp*ap*a)-3')
    Species: synthetic, synthetic
  • Chain 'H':
    Compound: DNA (5'-d(*tp*gp*ap*cp*tp*cp*tp*cp*tp*tp*ap*a)-3')
  • Chain 'M':
    Compound: DNA (5'-d(p*gp*ap*gp*ap*gp*tp*cp*a)-3')
    Species: synthetic, synthetic
  • Chain 'N':
    Compound: DNA (5'-d(p*gp*ap*gp*ap*gp*tp*cp*a)-3')
    Species: synthetic, synthetic
  • Chain 'O':
    Compound: DNA (5'-d(p*gp*gp*tp*ap*gp*cp*cp*a)-3')
  • Chain 'P':
    Compound: DNA (5'-d(p*gp*gp*tp*ap*gp*cp*cp*a)-3')
  • Heterogens: ZN, MG

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1evwA (A:)
    maltnaqilavidsweetvgqfpvithhvplggglqgtlhcyeiplaapygvgfakngpt
    rwqykrtinqvvhrwgshtvpfllepdningktctashlchntrchnplhlcwesaddnk
    grnwcpgpnggcvhavvclrqgplygpgatvagpqqrgshfvv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1evwA (A:)
    altnaqilavidsweetvgqfpvithhvplggglqgtlhcyeiplaapygvgfakngptr
    wqykrtinqvvhrwgshtvpfllepdningktctashlchntrchnplhlcwesaddnkg
    rnwcpgpnggcvhavvclrqgplygpgatvagpqqrgshfvv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1evwB (B:)
    maltnaqilavidsweetvgqfpvithhvplggglqgtlhcyeiplaapygvgfakngpt
    rwqykrtinqvvhrwgshtvpfllepdningktctashlchntrchnplhlcwesaddnk
    grnwcpgpnggcvhavvclrqgplygpgatvagpqqrgshfvv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1evwB (B:)
    altnaqilavidsweetvgqfpvithhvplggglqgtlhcyeiplaapygvgfakngptr
    wqykrtinqvvhrwgshtvpfllepdningktctashlchntrchnplhlcwesaddnkg
    rnwcpgpnggcvhavvclrqgplygpgatvagpqqrgshfvv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1evwC (C:)
    maltnaqilavidsweetvgqfpvithhvplggglqgtlhcyeiplaapygvgfakngpt
    rwqykrtinqvvhrwgshtvpfllepdningktctashlchntrchnplhlcwesaddnk
    grnwcpgpnggcvhavvclrqgplygpgatvagpqqrgshfvv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1evwC (C:)
    altnaqilavidsweetvgqfpvithhvplggglqgtlhcyeiplaapygvgfakngptr
    wqykrtinqvvhrwgshtvpfllepdningktctashlchntrchnplhlcwesaddnkg
    rnwcpgpnggcvhavvclrqgplygpgatvagpqqrgshfvv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1evwD (D:)
    maltnaqilavidsweetvgqfpvithhvplggglqgtlhcyeiplaapygvgfakngpt
    rwqykrtinqvvhrwgshtvpfllepdningktctashlchntrchnplhlcwesaddnk
    grnwcpgpnggcvhavvclrqgplygpgatvagpqqrgshfvv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1evwD (D:)
    altnaqilavidsweetvgqfpvithhvplggglqgtlhcyeiplaapygvgfakngptr
    wqykrtinqvvhrwgshtvpfllepdningktctashlchntrchnplhlcwesaddnkg
    rnwcpgpnggcvhavvclrqgplygpgatvagpqqrgshfvv
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'M':
    No sequence available.

  • Chain 'N':
    No sequence available.

  • Chain 'O':
    No sequence available.

  • Chain 'P':
    No sequence available.