PDB entry 1evu

View 1evu on RCSB PDB site
Description:
Deposited on 2000-04-20, released 2000-05-10
The last revision prior to the SCOP 1.55 freeze date was dated 2000-05-10, with a file datestamp of 2000-05-10.
Experiment type: XRAY
Resolution: 2.01 Å
R-factor: 0.208
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1evuA (A:)
    setsrtafggrravppnnsnaaeddlptvelqgvvprgvnlqeflnvtsvhlfkerwdtn
    kvdhhtdkyennklivrrgqsfyvqidfsrpydprrdlfrveyvigrypqenkgtyipvp
    ivselqsgkwgakivmredrsvrlsiqsspkcivgkfrmyvavwtpygvlrtsrnpetdt
    yilfnpwceddavyldnekereeyvlndigvifygevndiktrswsygqfedgildtcly
    vmdraqmdlsgrgnpikvsrvgsamvnakddegvlvgswdniyaygvppsawtgsvdill
    eyrssenpvrygqcwvfagvfntflrclgiparivtnyfsahdndanlqmdifleedgnv
    nskltkdsvwnyhcwneawmtrpdlpvgfggwqavdstpqensdgmyrcgpasvqaikhg
    hvcfqfdapfvfaevnsdliyitakkdgthvvenvdathigklivtkqiggdgmmditdt
    ykfqegqeeerlaletalmygakkplntegvmksrsnvdmdfevenavlgkdfklsitfr
    nnshnrytitaylsanitfytgvpkaefkketfdvtleplsfkkeavliqageymgqlle
    qaslhffvtarinetrdvlakqkstvltipeiiikvrgtqvvgsdmtvtvqftnplketl
    rnvwvhldgpgvtrpmkkmfreirpnstvqweevcrpwvsghrkliasmssdslrhvyge
    ldvqiqr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1evuA (A:)
    setsrtafggrravppnnsnaaeddlptveeflnvtsvhlfkerwdtnkvdhhtdkyenn
    klivrrgqsfyvqidfsrpydprrdlfrveyvigrypqenkgtyipvpivselqsgkwga
    kivmredrsvrlsiqsspkcivgkfrmyvavwtpygvlrtsrnpetdtyilfnpwcedda
    vyldnekereeyvlndigvifygevndiktrswsygqfedgildtclyvmdraqmdlsgr
    gnpikvsrvgsamvnakddegvlvgswdniyaygvppsawtgsvdilleyrssenpvryg
    qcwvfagvfntflrclgiparivtnyfsahdndanlqmdifleedgnvnskltkdsvwny
    hcwneawmtrpdlpvgfggwqavdstpqensdgmyrcgpasvqaikhghvcfqfdapfvf
    aevnsdliyitakkdgthvvenvdathigklivtkqiggdgmmditdtykfqegqeeerl
    aletalmygakkplntsnvdmdfevenavlgkdfklsitfrnnshnrytitaylsanitf
    ytgvpkaefkketfdvtleplsfkkeavliqageymgqlleqaslhffvtarinetrdvl
    akqkstvltipeiiikvrgtqvvgsdmtvtvqftnplketlrnvwvhldgpgvtrpmkkm
    freirpnstvqweevcrpwvsghrkliasmssdslrhvygeldvqiqr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1evuB (B:)
    fggrravppnnsnaaeddlptvelqgvvprgvnlqeflnvtsvhlfkerwdtnkvdhhtd
    kyennklivrrgqsfyvqidfsrpydprrdlfrveyvigrypqenkgtyipvpivselqs
    gkwgakivmredrsvrlsiqsspkcivgkfrmyvavwtpygvlrtsrnpetdtyilfnpw
    ceddavyldnekereeyvlndigvifygevndiktrswsygqfedgildtclyvmdraqm
    dlsgrgnpikvsrvgsamvnakddegvlvgswdniyaygvppsawtgsvdilleyrssen
    pvrygqcwvfagvfntflrclgiparivtnyfsahdndanlqmdifleedgnvnskltkd
    svwnyhcwneawmtrpdlpvgfggwqavdstpqensdgmyrcgpasvqaikhghvcfqfd
    apfvfaevnsdliyitakkdgthvvenvdathigklivtkqiggdgmmditdtykfqegq
    eeerlaletalmygakkplntegvmksrsnvdmdfevenavlgkdfklsitfrnnshnry
    titaylsanitfytgvpkaefkketfdvtleplsfkkeavliqageymgqlleqaslhff
    vtarinetrdvlakqkstvltipeiiikvrgtqvvgsdmtvtvqftnplketlrnvwvhl
    dgpgvtrpmkkmfreirpnstvqweevcrpwvsghrkliasmssdslrhvygeldvqiqr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1evuB (B:)
    fggrravppnnsnaaeddlptvelqgvvqeflnvtsvhlfkerwdtnkvdhhtdkyennk
    livrrgqsfyvqidfsrpydprrdlfrveyvigrypqenkgtyipvpivselqsgkwgak
    ivmredrsvrlsiqsspkcivgkfrmyvavwtpygvlrtsrnpetdtyilfnpwceddav
    yldnekereeyvlndigvifygevndiktrswsygqfedgildtclyvmdraqmdlsgrg
    npikvsrvgsamvnakddegvlvgswdniyaygvppsawtgsvdilleyrssenpvrygq
    cwvfagvfntflrclgiparivtnyfsahdndanlqmdifleedgnvnskltkdsvwnyh
    cwneawmtrpdlpvgfggwqavdstpqensdgmyrcgpasvqaikhghvcfqfdapfvfa
    evnsdliyitakkdgthvvenvdathigklivtkqiggdgmmditdtykfqegqeeerla
    letalmygakkplntrsnvdmdfevenavlgkdfklsitfrnnshnrytitaylsanitf
    ytgvpkaefkketfdvtleplsfkkeavliqageymgqlleqaslhffvtarinetrdvl
    akqkstvltipeiiikvrgtqvvgsdmtvtvqftnplketlrnvwvhldgpgvtrpmkkm
    freirpnstvqweevcrpwvsghrkliasmssdslrhvygeldvqiqr