PDB entry 1evt

View 1evt on RCSB PDB site
Description: crystal structure of fgf1 in complex with the extracellular ligand binding domain of fgf receptor 1 (fgfr1)
Deposited on 2000-04-20, released 2000-05-31
The last revision prior to the SCOP 1.55 freeze date was dated 2000-05-31, with a file datestamp of 2000-05-31.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.249
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1evtA (A:)
    ykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikstetgqylam
    dtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrgprthygq
    kailflplpvs
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1evtB (B:)
    ykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikstetgqylam
    dtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrgprthygq
    kailflplpvs
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1evtC (C:)
    nrmpvapywtspekmekklhavpaaktvkfkcpssgtpnptlrwlkngkefkpdhriggy
    kvryatwsiimdsvvpsdkgnytciveneygsinhtyqldvversphrpilqaglpankt
    valgsnvefmckvysdpqphiqwlkhievngskigpdnlpyvqilktagvnttdkemevl
    hlrnvsfedageytclagnsiglshhsawltvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1evtC (C:)
    nrmpvapywtspekmekklhavpaaktvkfkcpssgtpnptlrwlkngkefkpdhriggy
    kvryatwsiimdsvvpsdkgnytciveneygsinhtyqldvversphrpilqaglpankt
    valgsnvefmckvysdpqphiqwlkhinlpyvqilevlhlrnvsfedageytclagnsig
    lshhsawltvl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1evtD (D:)
    nrmpvapywtspekmekklhavpaaktvkfkcpssgtpnptlrwlkngkefkpdhriggy
    kvryatwsiimdsvvpsdkgnytciveneygsinhtyqldvversphrpilqaglpankt
    valgsnvefmckvysdpqphiqwlkhievngskigpdnlpyvqilktagvnttdkemevl
    hlrnvsfedageytclagnsiglshhsawltvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1evtD (D:)
    nrmpvapywtspekmekklhavpaaktvkfkcpssgtpnptlrwlkngkefkpdhriggy
    kvryatwsiimdsvvpsdkgnytciveneygsinhtyqldvversphrpilqaglpankt
    valgsnvefmckvysdpqphiqwlkhipyvqilktaevlhlrnvsfedageytclagnsi
    glshhsawltvl