PDB entry 1evt

View 1evt on RCSB PDB site
Description: crystal structure of fgf1 in complex with the extracellular ligand binding domain of fgf receptor 1 (fgfr1)
Class: growth factor/growth factor receptor
Keywords: immunoglobulin (ig) like domains belonging to the I-set subgroup within ig-like domains, b-trefoil fold, growth factor/growth factor receptor complex
Deposited on 2000-04-20, released 2000-05-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.249
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (fibroblast growth factor 1)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1evta_
  • Chain 'B':
    Compound: protein (fibroblast growth factor 1)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1evtb_
  • Chain 'C':
    Compound: protein (fibroblast growth factor receptor 1)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1evtc1, d1evtc2
  • Chain 'D':
    Compound: protein (fibroblast growth factor receptor 1)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1evtd1, d1evtd2
  • Heterogens: SO4

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1evtA (A:)
    nykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikstetgqyla
    mdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrgprthyg
    qkailflplpvssd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1evtA (A:)
    ykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikstetgqylam
    dtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrgprthygq
    kailflplpvs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1evtB (B:)
    nykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikstetgqyla
    mdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrgprthyg
    qkailflplpvssd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1evtB (B:)
    ykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikstetgqylam
    dtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrgprthygq
    kailflplpvs
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1evtC (C:)
    tdntkpnrmpvapywtspekmekklhavpaaktvkfkcpssgtpnptlrwlkngkefkpd
    hriggykvryatwsiimdsvvpsdkgnytciveneygsinhtyqldvversphrpilqag
    lpanktvalgsnvefmckvysdpqphiqwlkhievngskigpdnlpyvqilktagvnttd
    kemevlhlrnvsfedageytclagnsiglshhsawltvlealeer
    

    Sequence, based on observed residues (ATOM records): (download)
    >1evtC (C:)
    nrmpvapywtspekmekklhavpaaktvkfkcpssgtpnptlrwlkngkefkpdhriggy
    kvryatwsiimdsvvpsdkgnytciveneygsinhtyqldvversphrpilqaglpankt
    valgsnvefmckvysdpqphiqwlkhinlpyvqilevlhlrnvsfedageytclagnsig
    lshhsawltvl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1evtD (D:)
    tdntkpnrmpvapywtspekmekklhavpaaktvkfkcpssgtpnptlrwlkngkefkpd
    hriggykvryatwsiimdsvvpsdkgnytciveneygsinhtyqldvversphrpilqag
    lpanktvalgsnvefmckvysdpqphiqwlkhievngskigpdnlpyvqilktagvnttd
    kemevlhlrnvsfedageytclagnsiglshhsawltvlealeer
    

    Sequence, based on observed residues (ATOM records): (download)
    >1evtD (D:)
    nrmpvapywtspekmekklhavpaaktvkfkcpssgtpnptlrwlkngkefkpdhriggy
    kvryatwsiimdsvvpsdkgnytciveneygsinhtyqldvversphrpilqaglpankt
    valgsnvefmckvysdpqphiqwlkhipyvqilktaevlhlrnvsfedageytclagnsi
    glshhsawltvl