PDB entry 1evr

View 1evr on RCSB PDB site
Description: The structure of the resorcinol/insulin R6 hexamer
Class: hormone/growth factor
Keywords: R6 Insulin Hexamer, HORMONE-GROWTH FACTOR COMPLEX
Deposited on 2000-04-20, released 2000-12-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: insulin
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1evr.1
  • Chain 'B':
    Compound: insulin
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1evr.1
  • Chain 'C':
    Compound: insulin
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1evr.2
  • Chain 'D':
    Compound: insulin
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1evr.2
  • Chain 'E':
    Compound: insulin
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1evr.3
  • Chain 'F':
    Compound: insulin
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1evr.3
  • Chain 'G':
    Compound: insulin
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1evr.4
  • Chain 'H':
    Compound: insulin
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1evr.4
  • Chain 'I':
    Compound: insulin
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1evr.5
  • Chain 'J':
    Compound: insulin
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1evr.5
  • Chain 'K':
    Compound: insulin
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1evr.6
  • Chain 'L':
    Compound: insulin
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1evr.6
  • Heterogens: RCO, ZN, CL, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1evrA (A:)
    giveqcctsicslyqlenycn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1evrB (B:)
    fvnqhlcgshlvealylvcgergffytpkt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1evrB (B:)
    fvnqhlcgshlvealylvcgergffytpk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1evrC (C:)
    giveqcctsicslyqlenycn
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1evrD (D:)
    fvnqhlcgshlvealylvcgergffytpkt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1evrD (D:)
    fvnqhlcgshlvealylvcgergffytpk
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1evrE (E:)
    giveqcctsicslyqlenycn
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1evrF (F:)
    fvnqhlcgshlvealylvcgergffytpkt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1evrF (F:)
    vnqhlcgshlvealylvcgergffytpk
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1evrG (G:)
    giveqcctsicslyqlenycn
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1evrH (H:)
    fvnqhlcgshlvealylvcgergffytpkt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1evrH (H:)
    fvnqhlcgshlvealylvcgergffytpk
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1evrI (I:)
    giveqcctsicslyqlenycn
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1evrJ (J:)
    fvnqhlcgshlvealylvcgergffytpkt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1evrJ (J:)
    fvnqhlcgshlvealylvcgergffytpk
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1evrK (K:)
    giveqcctsicslyqlenycn
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1evrL (L:)
    fvnqhlcgshlvealylvcgergffytpkt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1evrL (L:)
    fvnqhlcgshlvealylvcgergffytpk