PDB entry 1evl

View 1evl on RCSB PDB site
Description: crystal structure of a truncated form of threonyl-tRNA synthetase with a threonyl adenylate analog
Class: ligase
Keywords: Amino acid recognition, zinc ion, tRNA-synthetase, adenylate analog, deletion mutant, LIGASE
Deposited on 2000-04-20, released 2000-07-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.215
AEROSPACI score: -1.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: threonyl-tRNA synthetase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1evla1, d1evla2
  • Chain 'B':
    Compound: threonyl-tRNA synthetase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1evlb1, d1evlb2
  • Chain 'C':
    Compound: threonyl-tRNA synthetase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1evlc1, d1evlc2
  • Chain 'D':
    Compound: threonyl-tRNA synthetase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1evld1, d1evld2
  • Heterogens: ZN, TSB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1evlA (A:)
    rdhrkigkqldlyhmqeeapgmvfwhndgwtifrelevfvrsklkeyqyqevkgpfmmdr
    vlwektghwdnykdamfttssenreycikpmncpghvqifnqglksyrdlplrmaefgsc
    hrnepsgslhglmrvrgftqddahifcteeqirdevngcirlvydmystfgfekivvkls
    trpekrigsdemwdraeadlavaleennipfeyqlgegafygpkieftlydcldrawqcg
    tvqldfslpsrlsasyvgednerkvpvmihrailgsmerfigilteefagffptwlapvq
    vvimnitdsqseyvneltqklsnagirvkadlrnekigfkirehtlrrvpymlvcgdkev
    esgkvavrtrrgkdlgsmdvnevieklqqeirsrslkqlee
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1evlB (B:)
    rdhrkigkqldlyhmqeeapgmvfwhndgwtifrelevfvrsklkeyqyqevkgpfmmdr
    vlwektghwdnykdamfttssenreycikpmncpghvqifnqglksyrdlplrmaefgsc
    hrnepsgslhglmrvrgftqddahifcteeqirdevngcirlvydmystfgfekivvkls
    trpekrigsdemwdraeadlavaleennipfeyqlgegafygpkieftlydcldrawqcg
    tvqldfslpsrlsasyvgednerkvpvmihrailgsmerfigilteefagffptwlapvq
    vvimnitdsqseyvneltqklsnagirvkadlrnekigfkirehtlrrvpymlvcgdkev
    esgkvavrtrrgkdlgsmdvnevieklqqeirsrslkqlee
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1evlC (C:)
    rdhrkigkqldlyhmqeeapgmvfwhndgwtifrelevfvrsklkeyqyqevkgpfmmdr
    vlwektghwdnykdamfttssenreycikpmncpghvqifnqglksyrdlplrmaefgsc
    hrnepsgslhglmrvrgftqddahifcteeqirdevngcirlvydmystfgfekivvkls
    trpekrigsdemwdraeadlavaleennipfeyqlgegafygpkieftlydcldrawqcg
    tvqldfslpsrlsasyvgednerkvpvmihrailgsmerfigilteefagffptwlapvq
    vvimnitdsqseyvneltqklsnagirvkadlrnekigfkirehtlrrvpymlvcgdkev
    esgkvavrtrrgkdlgsmdvnevieklqqeirsrslkqlee
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1evlD (D:)
    rdhrkigkqldlyhmqeeapgmvfwhndgwtifrelevfvrsklkeyqyqevkgpfmmdr
    vlwektghwdnykdamfttssenreycikpmncpghvqifnqglksyrdlplrmaefgsc
    hrnepsgslhglmrvrgftqddahifcteeqirdevngcirlvydmystfgfekivvkls
    trpekrigsdemwdraeadlavaleennipfeyqlgegafygpkieftlydcldrawqcg
    tvqldfslpsrlsasyvgednerkvpvmihrailgsmerfigilteefagffptwlapvq
    vvimnitdsqseyvneltqklsnagirvkadlrnekigfkirehtlrrvpymlvcgdkev
    esgkvavrtrrgkdlgsmdvnevieklqqeirsrslkqlee