PDB entry 1evk

View 1evk on RCSB PDB site
Description: crystal structure of a truncated form of threonyl-tRNA synthetase with the ligand threonine
Class: ligase
Keywords: tRNA-synthetase, threonine, zinc ion, deletion mutant, LIGASE
Deposited on 2000-04-20, released 2000-07-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.212
AEROSPACI score: -1.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: threonyl-tRNA synthetase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1evka1, d1evka2
  • Chain 'B':
    Compound: threonyl-tRNA synthetase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1evkb1, d1evkb2
  • Heterogens: ZN, THR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1evkA (A:)
    rdhrkigkqldlyhmqeeapgmvfwhndgwtifrelevfvrsklkeyqyqevkgpfmmdr
    vlwektghwdnykdamfttssenreycikpmncpghvqifnqglksyrdlplrmaefgsc
    hrnepsgslhglmrvrgftqddahifcteeqirdevngcirlvydmystfgfekivvkls
    trpekrigsdemwdraeadlavaleennipfeyqlgegafygpkieftlydcldrawqcg
    tvqldfslpsrlsasyvgednerkvpvmihrailgsmerfigilteefagffptwlapvq
    vvimnitdsqseyvneltqklsnagirvkadlrnekigfkirehtlrrvpymlvcgdkev
    esgkvavrtrrgkdlgsmdvnevieklqqeirsrslkqlee
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1evkB (B:)
    rdhrkigkqldlyhmqeeapgmvfwhndgwtifrelevfvrsklkeyqyqevkgpfmmdr
    vlwektghwdnykdamfttssenreycikpmncpghvqifnqglksyrdlplrmaefgsc
    hrnepsgslhglmrvrgftqddahifcteeqirdevngcirlvydmystfgfekivvkls
    trpekrigsdemwdraeadlavaleennipfeyqlgegafygpkieftlydcldrawqcg
    tvqldfslpsrlsasyvgednerkvpvmihrailgsmerfigilteefagffptwlapvq
    vvimnitdsqseyvneltqklsnagirvkadlrnekigfkirehtlrrvpymlvcgdkev
    esgkvavrtrrgkdlgsmdvnevieklqqeirsrslkqlee