PDB entry 1evj

View 1evj on RCSB PDB site
Description: crystal structure of glucose-fructose oxidoreductase (gfor) delta1-22 s64d
Deposited on 2000-04-20, released 2000-12-04
The last revision prior to the SCOP 1.57 freeze date was dated 2000-12-04, with a file datestamp of 2000-12-04.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.241
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1evjA (A:)
    rrfgyaivglgkyalnqilpgfagcqhsriealvdgnaekakivaaeygvdprkiydysn
    fdkiakdpkidavyiilpnslhaefairafkagkhvmcekpmatsvadcqrmidaakaan
    kklmigyrchydpmnraavklirenqlgklgmvttdnsdvmdqndpaqqwrlrrelaggg
    slmdigiyglngtryllgeepievraytysdpnderfvevedriiwqmrfrsgalshgas
    systtttsrfsvqgdkavllmdpatgyyqnlisvqtpghanqsmmpqfimpannqfsaql
    dhlaeavinnkpvrspgeegmqdvrliqaiyeaartgrpvntdwgyvrqggy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1evjA (A:)
    rrfgyaivglgkyalnqilpgfagcqhsriealvdgnaekakivaaeygvdprkiydysn
    fdkiakdpkidavyiilpnslhaefairafkagkhvmcekpmatsvadcqrmidaakaan
    kklmigyrchydpmnraavklirenqlgklgmvttdnsdvmdqndpaqqwrlrrelaggg
    slmdigiyglngtryllgeepievraytysdpnderfvevedriiwqmrfrsgalshgas
    systtttsrfsvqgdkavllmdpatgyyqnlisvqtpmpannqfsaqldhlaeavinnkp
    vrspgeegmqdvrliqaiyeaartgrpvntdwgyvrqggy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1evjB (B:)
    rrfgyaivglgkyalnqilpgfagcqhsriealvdgnaekakivaaeygvdprkiydysn
    fdkiakdpkidavyiilpnslhaefairafkagkhvmcekpmatsvadcqrmidaakaan
    kklmigyrchydpmnraavklirenqlgklgmvttdnsdvmdqndpaqqwrlrrelaggg
    slmdigiyglngtryllgeepievraytysdpnderfvevedriiwqmrfrsgalshgas
    systtttsrfsvqgdkavllmdpatgyyqnlisvqtpghanqsmmpqfimpannqfsaql
    dhlaeavinnkpvrspgeegmqdvrliqaiyeaartgrpvntdwgyvrqggy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1evjB (B:)
    rrfgyaivglgkyalnqilpgfagcqhsriealvdgnaekakivaaeygvdprkiydysn
    fdkiakdpkidavyiilpnslhaefairafkagkhvmcekpmatsvadcqrmidaakaan
    kklmigyrchydpmnraavklirenqlgklgmvttdnsdvmdqndpaqqwrlrrelaggg
    slmdigiyglngtryllgeepievraytysdpnderfvevedriiwqmrfrsgalshgas
    systtttsrfsvqgdkavllmdpatgyyqnlisvqtpannqfsaqldhlaeavinnkpvr
    spgeegmqdvrliqaiyeaartgrpvntdwgyvrqggy
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1evjC (C:)
    rrfgyaivglgkyalnqilpgfagcqhsriealvdgnaekakivaaeygvdprkiydysn
    fdkiakdpkidavyiilpnslhaefairafkagkhvmcekpmatsvadcqrmidaakaan
    kklmigyrchydpmnraavklirenqlgklgmvttdnsdvmdqndpaqqwrlrrelaggg
    slmdigiyglngtryllgeepievraytysdpnderfvevedriiwqmrfrsgalshgas
    systtttsrfsvqgdkavllmdpatgyyqnlisvqtpghanqsmmpqfimpannqfsaql
    dhlaeavinnkpvrspgeegmqdvrliqaiyeaartgrpvntdwgyvrqggy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1evjC (C:)
    rrfgyaivglgkyalnqilpgfagcqhsriealvdgnaekakivaaeygvdprkiydysn
    fdkiakdpkidavyiilpnslhaefairafkagkhvmcekpmatsvadcqrmidaakaan
    kklmigyrchydpmnraavklirenqlgklgmvttdnsdvmdqndpaqqwrlrrelaggg
    slmdigiyglngtryllgeepievraytysdpnderfvevedriiwqmrfrsgalshgas
    systtttsrfsvqgdkavllmdpatgyyqnlisvqtannqfsaqldhlaeavinnkpvrs
    pgeegmqdvrliqaiyeaartgrpvntdwgyvrqggy
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1evjD (D:)
    rrfgyaivglgkyalnqilpgfagcqhsriealvdgnaekakivaaeygvdprkiydysn
    fdkiakdpkidavyiilpnslhaefairafkagkhvmcekpmatsvadcqrmidaakaan
    kklmigyrchydpmnraavklirenqlgklgmvttdnsdvmdqndpaqqwrlrrelaggg
    slmdigiyglngtryllgeepievraytysdpnderfvevedriiwqmrfrsgalshgas
    systtttsrfsvqgdkavllmdpatgyyqnlisvqtpghanqsmmpqfimpannqfsaql
    dhlaeavinnkpvrspgeegmqdvrliqaiyeaartgrpvntdwgyvrqggy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1evjD (D:)
    rrfgyaivglgkyalnqilpgfagcqhsriealvdgnaekakivaaeygvdprkiydysn
    fdkiakdpkidavyiilpnslhaefairafkagkhvmcekpmatsvadcqrmidaakaan
    kklmigyrchydpmnraavklirenqlgklgmvttdnsdvmdqndpaqqwrlrrelaggg
    slmdigiyglngtryllgeepievraytysdpnderfvevedriiwqmrfrsgalshgas
    systtttsrfsvqgdkavllmdpatgyyqnlisvqtpgnnqfsaqldhlaeavinnkpvr
    spgeegmqdvrliqaiyeaartgrpvntdwgyvrqggy