PDB entry 1evh

View 1evh on RCSB PDB site
Description: evh1 domain from murine enabled in complex with acta peptide
Class: contractile protein
Keywords: molecular recognition, actin dynamics, contractile protein
Deposited on 1999-04-21, released 1999-05-21
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.23
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (mena evh1 domain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1evha_
  • Chain 'B':
    Compound: Peptide ACTA
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1EVH
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1evhA (A:)
mseqsicqaraavmvyddankkwvpaggstgfsrvhiyhhtgnntfrvvgrkiqdhqvvi
ncaipkglkynqatqtfhqwrdarqvyglnfgskedanvfasammhalevln

    Sequence, based on observed residues (ATOM records): (download) 
    >1evhA (A:)
seqsicqaraavmvyddankkwvpaggstgfsrvhiyhhtgnntfrvvgrkiqdhqvvin
caipkglkynqatqtfhqwrdarqvyglnfgskedanvfasammhalevln

  • Chain 'B':
    No sequence available.