PDB entry 1evf

View 1evf on RCSB PDB site
Description: crystal structure analysis of cys167 mutant of escherichia coli
Class: transferase
Keywords: Thr167 E. coli Thymidylate Synthase, TRANSFERASE
Deposited on 2000-04-19, released 2000-05-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-31, with a file datestamp of 2018-01-26.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thymidylate synthase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A884 (0-263)
      • modified residue (0)
      • modified residue (49)
      • modified residue (145)
      • engineered (166)
      • modified residue (167)
      • modified residue (191)
    Domains in SCOPe 2.08: d1evfa_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1evfA (A:)
    mkqylelmqkvldegtqkndrtgtgtlsifghqmrfnlqdgfplvttkrchlrsiihell
    wflqgdtniaylhennvtiwdewadengdlgpvygkqwrawptpdgrhidqittvlnqlk
    ndpdsrriivsawnvgeldkmalapchaffqfyvadgklscqlyqrtcdvflglpfnias
    yallvhmmaqqcdlevgdfvwtggdthlysnhmdqthlqlsreprplpkliikrkpesif
    dyrfedfeiegydphpgikapvai