PDB entry 1ev9

View 1ev9 on RCSB PDB site
Description: rat glutathione s-transferase a1-1 mutant w21f with gso3 bound
Class: transferase
Keywords: disordered C-terminal helices, TRANSFERASE
Deposited on 2000-04-19, released 2001-02-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutathione s-transferase a1-1
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00502 (0-End)
      • engineered (19)
      • conflict (94)
    Domains in SCOPe 2.07: d1ev9a1, d1ev9a2
  • Chain 'C':
    Compound: glutathione s-transferase a1-1
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00502 (0-End)
      • engineered (19)
      • conflict (94)
    Domains in SCOPe 2.07: d1ev9c1, d1ev9c2
  • Chain 'D':
    Compound: glutathione s-transferase a1-1
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00502 (0-End)
      • engineered (19)
      • conflict (94)
    Domains in SCOPe 2.07: d1ev9d1, d1ev9d2
  • Heterogens: SO4, GTS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ev9A (A:)
    sgkpvlhyfnargrmecirfllaaagvefdekfiqspedleklkkdgnlmfdqvpmveid
    gmklaqtrailnyiatkydlygkdmkeralidmysegildltemimqlvicppdqkeakt
    alakdrtknrylpafekvlkshgqdylvgnkltrvdihllelllyveefdaslltsfpll
    kafksrisslpnvkkflqpgsqrklpmdakqieearkifkf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ev9A (A:)
    sgkpvlhyfnargrmecirfllaaagvefdekfiqspedleklkkdgnlmfdqvpmveid
    gmklaqtrailnyiatkydlygkdmkeralidmysegildltemimqlvicppdqkeakt
    alakdrtknrylpafekvlkshgqdylvgnkltrvdihllelllyveefdaslltsfpll
    kafksrisslpnvkkflqpgsqrklpmdakqieearkif
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ev9C (C:)
    sgkpvlhyfnargrmecirfllaaagvefdekfiqspedleklkkdgnlmfdqvpmveid
    gmklaqtrailnyiatkydlygkdmkeralidmysegildltemimqlvicppdqkeakt
    alakdrtknrylpafekvlkshgqdylvgnkltrvdihllelllyveefdaslltsfpll
    kafksrisslpnvkkflqpgsqrklpmdakqieearkifkf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ev9C (C:)
    sgkpvlhyfnargrmecirfllaaagvefdekfiqspedleklkkdgnlmfdqvpmveid
    gmklaqtrailnyiatkydlygkdmkeralidmysegildltemimqlvicppdqkeakt
    alakdrtknrylpafekvlkshgqdylvgnkltrvdihllelllyveefdaslltsfpll
    kafksrisslpnvkkflqpgsqrklpm
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ev9D (D:)
    sgkpvlhyfnargrmecirfllaaagvefdekfiqspedleklkkdgnlmfdqvpmveid
    gmklaqtrailnyiatkydlygkdmkeralidmysegildltemimqlvicppdqkeakt
    alakdrtknrylpafekvlkshgqdylvgnkltrvdihllelllyveefdaslltsfpll
    kafksrisslpnvkkflqpgsqrklpmdakqieearkifkf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ev9D (D:)
    sgkpvlhyfnargrmecirfllaaagvefdekfiqspedleklkkdgnlmfdqvpmveid
    gmklaqtrailnyiatkydlygkdmkeralidmysegildltemimqlvicppdqkeakt
    alakdrtknrylpafekvlkshgqdylvgnkltrvdihllelllyveefdaslltsfpll
    kafksrisslpnvkkflqpgsqrklpmdakqieear