PDB entry 1ev6

View 1ev6 on RCSB PDB site
Description: Structure of the monoclinic form of the M-cresol/insulin R6 hexamer
Class: hormone/growth factor
Keywords: R6 Hexameric Insulin, HORMONE/GROWTH FACTOR COMPLEX
Deposited on 2000-04-19, released 2000-12-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.195
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: insulin
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ev6.1
  • Chain 'B':
    Compound: insulin
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ev6.1
  • Chain 'C':
    Compound: insulin
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ev6.2
  • Chain 'D':
    Compound: insulin
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ev6.2
  • Chain 'E':
    Compound: insulin
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ev6.3
  • Chain 'F':
    Compound: insulin
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ev6.3
  • Chain 'G':
    Compound: insulin
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ev6.4
  • Chain 'H':
    Compound: insulin
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ev6.4
  • Chain 'I':
    Compound: insulin
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ev6.5
  • Chain 'J':
    Compound: insulin
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ev6.5
  • Chain 'K':
    Compound: insulin
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ev6.6
  • Chain 'L':
    Compound: insulin
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ev6.6
  • Heterogens: ZN, CL, NA, CRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ev6A (A:)
    giveqcctsicslyqlenycn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ev6B (B:)
    fvnqhlcgshlvealylvcgergffytpkt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ev6B (B:)
    fvnqhlcgshlvealylvcgergffytpk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ev6C (C:)
    giveqcctsicslyqlenycn
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ev6D (D:)
    fvnqhlcgshlvealylvcgergffytpkt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ev6D (D:)
    fvnqhlcgshlvealylvcgergffytpk
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ev6E (E:)
    giveqcctsicslyqlenycn
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ev6F (F:)
    fvnqhlcgshlvealylvcgergffytpkt
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ev6G (G:)
    giveqcctsicslyqlenycn
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1ev6H (H:)
    fvnqhlcgshlvealylvcgergffytpkt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ev6H (H:)
    fvnqhlcgshlvealylvcgergffytpk
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ev6I (I:)
    giveqcctsicslyqlenycn
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1ev6J (J:)
    fvnqhlcgshlvealylvcgergffytpkt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ev6J (J:)
    fvnqhlcgshlvealylvcgergffytpk
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ev6K (K:)
    giveqcctsicslyqlenycn
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1ev6L (L:)
    fvnqhlcgshlvealylvcgergffytpkt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ev6L (L:)
    fvnqhlcgshlvealylvcgergffytpk