PDB entry 1ev6

View 1ev6 on RCSB PDB site
Description: Structure of the monoclinic form of the M-cresol/insulin R6 hexamer
Class: hormone/growth factor
Keywords: R6 Hexameric Insulin, HORMONE/GROWTH FACTOR COMPLEX
Deposited on 2000-04-19, released 2000-12-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.195
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: insulin
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-20)
  Domains in SCOPe 2.08: d1ev6.1
• Chain 'B':
  Compound: insulin
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-End)
  Domains in SCOPe 2.08: d1ev6.1
• Chain 'C':
  Compound: insulin
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-20)
  Domains in SCOPe 2.08: d1ev6.2
• Chain 'D':
  Compound: insulin
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-End)
  Domains in SCOPe 2.08: d1ev6.2
• Chain 'E':
  Compound: insulin
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-20)
  Domains in SCOPe 2.08: d1ev6.3
• Chain 'F':
  Compound: insulin
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-29)
  Domains in SCOPe 2.08: d1ev6.3
• Chain 'G':
  Compound: insulin
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-20)
  Domains in SCOPe 2.08: d1ev6.4
• Chain 'H':
  Compound: insulin
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-End)
  Domains in SCOPe 2.08: d1ev6.4
• Chain 'I':
  Compound: insulin
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-20)
  Domains in SCOPe 2.08: d1ev6.5
• Chain 'J':
  Compound: insulin
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-End)
  Domains in SCOPe 2.08: d1ev6.5
• Chain 'K':
  Compound: insulin
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-20)
  Domains in SCOPe 2.08: d1ev6.6
• Chain 'L':
  Compound: insulin
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-End)
  Domains in SCOPe 2.08: d1ev6.6
• Heterogens: ZN, CL, NA, CRS, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ev6A (A:)
  giveqcctsicslyqlenycn
  

  
  
• Chain 'B':
  Sequence, based on SEQRES records: (download)
  

  >1ev6B (B:)
  fvnqhlcgshlvealylvcgergffytpkt
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1ev6B (B:)
  fvnqhlcgshlvealylvcgergffytpk
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ev6C (C:)
  giveqcctsicslyqlenycn
  

  
  
• Chain 'D':
  Sequence, based on SEQRES records: (download)
  

  >1ev6D (D:)
  fvnqhlcgshlvealylvcgergffytpkt
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1ev6D (D:)
  fvnqhlcgshlvealylvcgergffytpk
  

  
  
• Chain 'E':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ev6E (E:)
  giveqcctsicslyqlenycn
  

  
  
• Chain 'F':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ev6F (F:)
  fvnqhlcgshlvealylvcgergffytpkt
  

  
  
• Chain 'G':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ev6G (G:)
  giveqcctsicslyqlenycn
  

  
  
• Chain 'H':
  Sequence, based on SEQRES records: (download)
  

  >1ev6H (H:)
  fvnqhlcgshlvealylvcgergffytpkt
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1ev6H (H:)
  fvnqhlcgshlvealylvcgergffytpk
  

  
  
• Chain 'I':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ev6I (I:)
  giveqcctsicslyqlenycn
  

  
  
• Chain 'J':
  Sequence, based on SEQRES records: (download)
  

  >1ev6J (J:)
  fvnqhlcgshlvealylvcgergffytpkt
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1ev6J (J:)
  fvnqhlcgshlvealylvcgergffytpk
  

  
  
• Chain 'K':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ev6K (K:)
  giveqcctsicslyqlenycn
  

  
  
• Chain 'L':
  Sequence, based on SEQRES records: (download)
  

  >1ev6L (L:)
  fvnqhlcgshlvealylvcgergffytpkt
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1ev6L (L:)
  fvnqhlcgshlvealylvcgergffytpk