PDB entry 1ev3

View 1ev3 on RCSB PDB site
Description: Structure of the rhombohedral form of the M-cresol/insulin R6 hexamer
Class: hormone/growth factor
Keywords: R6 Hexamer, 18-A, HORMONE-GROWTH FACTOR COMPLEX
Deposited on 2000-04-19, released 2000-12-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.78 Å
R-factor: 0.2
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: insulin
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ev3.1
  • Chain 'B':
    Compound: insulin
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ev3.1
  • Chain 'C':
    Compound: insulin
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ev3.2
  • Chain 'D':
    Compound: insulin
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ev3.2
  • Heterogens: ZN, CL, CRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ev3A (A:)
    giveqcctsicslyqlenycn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ev3B (B:)
    fvnqhlcgshlvealylvcgergffytpkt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ev3B (B:)
    fvnqhlcgshlvealylvcgergffytp
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ev3C (C:)
    giveqcctsicslyqlenycn
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ev3D (D:)
    fvnqhlcgshlvealylvcgergffytpkt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ev3D (D:)
    fvnqhlcgshlvealylvcgergffytp