PDB entry 1ev2

View 1ev2 on RCSB PDB site
Description: crystal structure of fgf2 in complex with the extracellular ligand binding domain of fgf receptor 2 (fgfr2)
Class: growth factor/growth factor receptor
Keywords: immunoglobulin (ig)like domains belonging to the I-set subgroup within ig-like domains, b-trefoil fold, growth factor/growth factor receptor complex
Deposited on 2000-04-19, released 2000-05-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.248
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (fibroblast growth factor 2)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09038
      • engineered (54)
      • engineered (72)
    Domains in SCOPe 2.06: d1ev2a_
  • Chain 'B':
    Compound: protein (fibroblast growth factor 2)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09038
      • engineered (54)
      • engineered (72)
    Domains in SCOPe 2.06: d1ev2b_
  • Chain 'C':
    Compound: protein (fibroblast growth factor 2)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09038
      • engineered (54)
      • engineered (72)
    Domains in SCOPe 2.06: d1ev2c_
  • Chain 'D':
    Compound: protein (fibroblast growth factor 2)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09038
      • engineered (54)
      • engineered (72)
    Domains in SCOPe 2.06: d1ev2d_
  • Chain 'E':
    Compound: protein (fibroblast growth factor receptor 2)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ev2e1, d1ev2e2
  • Chain 'F':
    Compound: protein (fibroblast growth factor receptor 2)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ev2f1, d1ev2f2
  • Chain 'G':
    Compound: protein (fibroblast growth factor receptor 2)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ev2g1, d1ev2g2
  • Chain 'H':
    Compound: protein (fibroblast growth factor receptor 2)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ev2h1, d1ev2h2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ev2A (A:)
    ghfkdpkrlycknggfflrihpdgrvdgvreksdphiklqlqaeergvvsikgvsanryl
    amkedgrllasksvtdecffferlesnnyntyrsrkytswyvalkrtgqyklgsktgpgq
    kailflpmsaks
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ev2A (A:)
    hfkdpkrlycknggfflrihpdgrvdgvreksdphiklqlqaeergvvsikgvsanryla
    mkedgrllasksvtdecffferlesnnyntyrsrkytswyvalkrtgqyklgsktgpgqk
    ailflpmsak
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ev2B (B:)
    ghfkdpkrlycknggfflrihpdgrvdgvreksdphiklqlqaeergvvsikgvsanryl
    amkedgrllasksvtdecffferlesnnyntyrsrkytswyvalkrtgqyklgsktgpgq
    kailflpmsaks
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ev2B (B:)
    hfkdpkrlycknggfflrihpdgrvdgvreksdphiklqlqaeergvvsikgvsanryla
    mkedgrllasksvtdecffferlesnnyntyrsrkytswyvalkrtgqyklgsktgpgqk
    ailflpmsak
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ev2C (C:)
    ghfkdpkrlycknggfflrihpdgrvdgvreksdphiklqlqaeergvvsikgvsanryl
    amkedgrllasksvtdecffferlesnnyntyrsrkytswyvalkrtgqyklgsktgpgq
    kailflpmsaks
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ev2C (C:)
    hfkdpkrlycknggfflrihpdgrvdgvreksdphiklqlqaeergvvsikgvsanryla
    mkedgrllasksvtdecffferlesnnyntyrsrkytswyvalkrtgqyklgsktgpgqk
    ailflpmsak
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ev2D (D:)
    ghfkdpkrlycknggfflrihpdgrvdgvreksdphiklqlqaeergvvsikgvsanryl
    amkedgrllasksvtdecffferlesnnyntyrsrkytswyvalkrtgqyklgsktgpgq
    kailflpmsaks
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ev2D (D:)
    hfkdpkrlycknggfflrihpdgrvdgvreksdphiklqlqaeergvvsikgvsanryla
    mkedgrllasksvtdecffferlesnnyntyrsrkytswyvalkrtgqyklgsktgpgqk
    ailflpmsak
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1ev2E (E:)
    nsnnkrapywtntekmekrlhavpaantvkfrcpaggnpmptmrwlkngkefkqehrigg
    ykvrnqhwslimesvvpsdkgnytcvveneygsinhtyhldvversphrpilqaglpana
    stvvggdvefvckvysdaqphiqwikhvekngskygpdglpylkvlkaagvnttdkeiev
    lyirnvtfedageytclagnsigisfhsawltvlpapgre
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ev2E (E:)
    nkrapywtntekmekrlhavpaantvkfrcpaggnpmptmrwlkngkefkqehriggykv
    rnqhwslimesvvpsdkgnytcvveneygsinhtyhldvversphrpilqaglpanasdv
    efvckvysdaqphiqwikhvpylkvlkaagvnttdkeievlyirnvtfedageytclagn
    sigisfhsawltvl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1ev2F (F:)
    nsnnkrapywtntekmekrlhavpaantvkfrcpaggnpmptmrwlkngkefkqehrigg
    ykvrnqhwslimesvvpsdkgnytcvveneygsinhtyhldvversphrpilqaglpana
    stvvggdvefvckvysdaqphiqwikhvekngskygpdglpylkvlkaagvnttdkeiev
    lyirnvtfedageytclagnsigisfhsawltvlpapgre
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ev2F (F:)
    nkrapywtntekmekrlhavpaantvkfrcpaggnpmptmrwlkngkefkqehriggykv
    rnqhwslimesvvpsdkgnytcvveneygsinhtyhldvversphrpilqaglpanastv
    vgdvefvckvysdaqphiqwikhylkvlkaagvnttdkeievlyirnvtfedageytcla
    gnsigisfhsawltv
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1ev2G (G:)
    nsnnkrapywtntekmekrlhavpaantvkfrcpaggnpmptmrwlkngkefkqehrigg
    ykvrnqhwslimesvvpsdkgnytcvveneygsinhtyhldvversphrpilqaglpana
    stvvggdvefvckvysdaqphiqwikhvekngskygpdglpylkvlkaagvnttdkeiev
    lyirnvtfedageytclagnsigisfhsawltvlpapgre
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ev2G (G:)
    krapywtntekmekrlhavpaantvkfrcpaggnpmptmrwlkngkefkqehriggykvr
    nqhwslimesvvpsdkgnytcvveneygsinhtyhldvversphrpilqaglpanastvv
    ggdvefvckvysdaqphiqwikhvylkvlkaagvnttdkeievlyirnvtfedageytcl
    agnsigisfhsawltvlpap
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1ev2H (H:)
    nsnnkrapywtntekmekrlhavpaantvkfrcpaggnpmptmrwlkngkefkqehrigg
    ykvrnqhwslimesvvpsdkgnytcvveneygsinhtyhldvversphrpilqaglpana
    stvvggdvefvckvysdaqphiqwikhvekngskygpdglpylkvlkaagvnttdkeiev
    lyirnvtfedageytclagnsigisfhsawltvlpapgre
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ev2H (H:)
    krapywtntekmekrlhavpaantvkfrcpaggnpmptmrwlkngkefkqehriggykvr
    nqhwslimesvvpsdkgnytcvveneygsinhtyhldvversphrpilqaglpanastvv
    ggdvefvckvysdaqphiqwikhvpylkvlkaagvnttdkeievlyirnvtfedageytc
    lagnsigisfhsawltvlpap