PDB entry 1ev2

View 1ev2 on RCSB PDB site
Description: crystal structure of fgf2 in complex with the extracellular ligand binding domain of fgf receptor 2 (fgfr2)
Deposited on 2000-04-19, released 2000-05-31
The last revision prior to the SCOP 1.55 freeze date was dated 2000-05-31, with a file datestamp of 2000-05-31.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.248
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ev2A (A:)
    hfkdpkrlycknggfflrihpdgrvdgvreksdphiklqlqaeergvvsikgvsanryla
    mkedgrllasksvtdecffferlesnnyntyrsrkytswyvalkrtgqyklgsktgpgqk
    ailflpmsak
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ev2B (B:)
    hfkdpkrlycknggfflrihpdgrvdgvreksdphiklqlqaeergvvsikgvsanryla
    mkedgrllasksvtdecffferlesnnyntyrsrkytswyvalkrtgqyklgsktgpgqk
    ailflpmsak
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ev2C (C:)
    hfkdpkrlycknggfflrihpdgrvdgvreksdphiklqlqaeergvvsikgvsanryla
    mkedgrllasksvtdecffferlesnnyntyrsrkytswyvalkrtgqyklgsktgpgqk
    ailflpmsak
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ev2D (D:)
    hfkdpkrlycknggfflrihpdgrvdgvreksdphiklqlqaeergvvsikgvsanryla
    mkedgrllasksvtdecffferlesnnyntyrsrkytswyvalkrtgqyklgsktgpgqk
    ailflpmsak
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1ev2E (E:)
    nkrapywtntekmekrlhavpaantvkfrcpaggnpmptmrwlkngkefkqehriggykv
    rnqhwslimesvvpsdkgnytcvveneygsinhtyhldvversphrpilqaglpanastv
    vggdvefvckvysdaqphiqwikhvekngskygpdglpylkvlkaagvnttdkeievlyi
    rnvtfedageytclagnsigisfhsawltvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ev2E (E:)
    nkrapywtntekmekrlhavpaantvkfrcpaggnpmptmrwlkngkefkqehriggykv
    rnqhwslimesvvpsdkgnytcvveneygsinhtyhldvversphrpilqaglpanasdv
    efvckvysdaqphiqwikhvpylkvlkaagvnttdkeievlyirnvtfedageytclagn
    sigisfhsawltvl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1ev2F (F:)
    nkrapywtntekmekrlhavpaantvkfrcpaggnpmptmrwlkngkefkqehriggykv
    rnqhwslimesvvpsdkgnytcvveneygsinhtyhldvversphrpilqaglpanastv
    vggdvefvckvysdaqphiqwikhvekngskygpdglpylkvlkaagvnttdkeievlyi
    rnvtfedageytclagnsigisfhsawltv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ev2F (F:)
    nkrapywtntekmekrlhavpaantvkfrcpaggnpmptmrwlkngkefkqehriggykv
    rnqhwslimesvvpsdkgnytcvveneygsinhtyhldvversphrpilqaglpanastv
    vgdvefvckvysdaqphiqwikhylkvlkaagvnttdkeievlyirnvtfedageytcla
    gnsigisfhsawltv
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1ev2G (G:)
    krapywtntekmekrlhavpaantvkfrcpaggnpmptmrwlkngkefkqehriggykvr
    nqhwslimesvvpsdkgnytcvveneygsinhtyhldvversphrpilqaglpanastvv
    ggdvefvckvysdaqphiqwikhvekngskygpdglpylkvlkaagvnttdkeievlyir
    nvtfedageytclagnsigisfhsawltvlpap
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ev2G (G:)
    krapywtntekmekrlhavpaantvkfrcpaggnpmptmrwlkngkefkqehriggykvr
    nqhwslimesvvpsdkgnytcvveneygsinhtyhldvversphrpilqaglpanastvv
    ggdvefvckvysdaqphiqwikhvylkvlkaagvnttdkeievlyirnvtfedageytcl
    agnsigisfhsawltvlpap
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1ev2H (H:)
    krapywtntekmekrlhavpaantvkfrcpaggnpmptmrwlkngkefkqehriggykvr
    nqhwslimesvvpsdkgnytcvveneygsinhtyhldvversphrpilqaglpanastvv
    ggdvefvckvysdaqphiqwikhvekngskygpdglpylkvlkaagvnttdkeievlyir
    nvtfedageytclagnsigisfhsawltvlpap
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ev2H (H:)
    krapywtntekmekrlhavpaantvkfrcpaggnpmptmrwlkngkefkqehriggykvr
    nqhwslimesvvpsdkgnytcvveneygsinhtyhldvversphrpilqaglpanastvv
    ggdvefvckvysdaqphiqwikhvpylkvlkaagvnttdkeievlyirnvtfedageytc
    lagnsigisfhsawltvlpap