PDB entry 1ev1

View 1ev1 on RCSB PDB site
Description: echovirus 1
Class: Virus
Keywords: VIRAL COAT PROTEIN, CAPSID, PICORNAVIRUS, ECHOVIRUS, Icosahedral virus
Deposited on 1997-12-02, released 1999-01-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.55 Å
R-factor: 0.263
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Compound: echovirus 1
    Species: Human echovirus 1 [TaxId:46633]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ev11_
  • Chain '2':
    Compound: echovirus 1
    Species: Human echovirus 1 [TaxId:46633]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ev1.1
  • Chain '3':
    Compound: echovirus 1
    Species: Human echovirus 1 [TaxId:46633]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ev13_
  • Chain '4':
    Compound: echovirus 1
    Species: Human echovirus 1 [TaxId:46633]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ev1.1
  • Heterogens: MYR, PLM, HOH

PDB Chain Sequences:

  • Chain '1':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ev11 (1:)
    gdvqnavegamvrvadtvqtsatnservpnltavetghtsqavpgdtmqtrhvinnhvrs
    estienflarsacvfyleyktgtkedsnsfnnwvittrrvaqlrrklemftylrfdmeit
    vvitssqdqstsqnqnapvlthqimyvppggpipvsvddyswqtstnpsifwtegnapar
    msipfisignaysnfydgwshfsqagvygfttlnnmgqlffrhvnkpnpaaitsvariyf
    kpkhvrawvprpprlcpyinstnvnfepkpvtevrtniitt
    

  • Chain '2':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ev12 (2:)
    gysdrvrsitlgnstittqecanvvvgygewpeylsdneataedqptqpdvatcrfytld
    svqwengspgwwwkfpdalrdmglfgqnmyyhylgragytihvqcnaskfhqgcilvvcv
    peaemgsaqtsgvvnyehiskgeiasrftttttaedhgvqaavwnagmgvgvgnltifph
    qwinlrtnnsativmpyvnsvpmdnmyrhhnftlmiipfvpldfsagastyvpitvtvap
    mcaeynglrlaghq
    

  • Chain '3':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ev13 (3:)
    glptmntpgsnqfltsddfqspsampqfdvtpemhipgevrnlmeiaevdsvmpinndsa
    akvssmeayrvelstntnagtqvfgfqlnpgaesvmnrtlmgeilnyyahwsgsikitfv
    fcgsamttgkfllsyappgagapktrkdamlgthvvwdvglqsscvlcipwisqthyrfv
    ekdpytnagfvtcwyqtsvvspasnqpkcymmcmvsacndfsvrmlrdtkfieqtsfyq
    

  • Chain '4':
    Sequence, based on SEQRES records: (download)
    >1ev14 (4:)
    gaqvstqktgahetslsatgnsiihytninyykdaasnsanrqdftqdpgkftepmkdvm
    iktlpaln
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ev14 (4:)
    gaqvstqktgahetsiihytninyykdaasnsanrqdftqdpgkftepmkdvmiktlpal
    n