PDB entry 1euy

View 1euy on RCSB PDB site
Description: glutaminyl-tRNA synthetase complexed with a tRNA mutant and an active site inhibitor
Class: ligase/RNA
Keywords: TRNA SYNTHETASE, GLUTAMINE, TRNAGLN, E. COLI, COMPLEX, ligase/RNA COMPLEX
Deposited on 2000-04-19, released 2000-06-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.234
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutaminyl-tRNA synthetase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1euya1, d1euya2
  • Chain 'B':
    Compound: glutaminyl tRNA
    Species: synthetic, synthetic
  • Heterogens: QSI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1euyA (A:)
    mseaearptnfirqiidedlasgkhttvhtrfppepngylhighaksiclnfgiaqdykg
    qcnlrfddtnpvkedieyvesikndvewlgfhwsgnvryssdyfdqlhayaielinkgla
    yvdeltpeqireyrgtltqpgknspyrdrsveenlalfekmraggfeegkaclrakidma
    spfivmrdpvlyrikfaehhqtgnkwciypmydfthcisdalegithslctlefqdnrrl
    ydwvldnitipvhprqyefsrlnleytvmskrklnllvtdkhvegwddprmptisglrrr
    gytaasirefckrigvtkqdntiemaslesciredlnenapramavidpvklvienyqge
    gemvtmpnhpnkpemgsrqvpfsgeiwidradfreeankqykrlvlgkevrlrnayvika
    ervekdaegnittifctydadtlskdpadgrkvkgvihwvsaahalpveirlydrlfsvp
    npgaaddflsvinpeslvikqgfaepslkdavagkafqferegyfcldsrhstaekpvfn
    rtvglrdt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1euyA (A:)
    tnfirqiidedlasgkhttvhtrfppepngylhighaksiclnfgiaqdykgqcnlrfdd
    tnpvkedieyvesikndvewlgfhwsgnvryssdyfdqlhayaielinkglayvdeltpe
    qireyrgtltqpgknspyrdrsveenlalfekmraggfeegkaclrakidmaspfivmrd
    pvlyrikfaehhqtgnkwciypmydfthcisdalegithslctlefqdnrrlydwvldni
    tipvhprqyefsrlnleytvmskrklnllvtdkhvegwddprmptisglrrrgytaasir
    efckrigvtkqdntiemaslesciredlnenapramavidpvklvienyqgegemvtmpn
    hpnkpemgsrqvpfsgeiwidradfreeankqykrlvlgkevrlrnayvikaervekdae
    gnittifctydadtlgvihwvsaahalpveirlydrlfsvpnpgaaddflsvinpeslvi
    kqgfaepslkdavagkafqferegyfcldsrhstaekpvfnrtvglrdt
    

  • Chain 'B':
    No sequence available.