PDB entry 1euw

View 1euw on RCSB PDB site
Description: atomic resolution structure of e. coli dutpase
Class: hydrolase
Keywords: jelly roll, mercury derivative, HYDROLASE
Deposited on 2000-04-17, released 2000-05-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-06-04, with a file datestamp of 2014-05-30.
Experiment type: XRAY
Resolution: 1.05 Å
R-factor: 0.141
AEROSPACI score: 0.88 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: deoxyuridine 5'-triphosphate nucleotidohydrolase
    Species: Escherichia coli [TaxId:562]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06968 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.06: d1euwa1, d1euwa2
  • Heterogens: EMC, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1euwA (A:)
    mmkkidvkildprvgkefplptyatsgsagldlraclndavelapgdttlvptglaihia
    dpslaammlprsglghkhgivlgnlvglidsdyqgqlmisvwnrgqdsftiqpgeriaqm
    ifvpvvqaefnlvedfdatdrgeggfghsgrq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1euwA (A:)
    mmkkidvkildprvgkefplptyatsgsagldlraclndavelapgdttlvptglaihia
    dpslaammlprsglghkhgivlgnlvglidsdyqgqlmisvwnrgqdsftiqpgeriaqm
    ifvpvvqaefnlvedf