PDB entry 1euv

View 1euv on RCSB PDB site
Description: x-ray structure of the c-terminal ulp1 protease domain in complex with smt3, the yeast ortholog of sumo.
Class: hydrolase
Keywords: sumo hydrolase, ubiquitin-like protease 1, smt3 hydrolase desumoylating enzyme, cysteine protease, sumo processing enzyme, smt3 processing enzyme, nabh4, thiohemiacetal, covalent protease adduct
Deposited on 2000-04-17, released 2000-06-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.193
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ulp1 protease
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02724 (0-220)
      • cloning artifacts (0-1)
    Domains in SCOPe 2.08: d1euva1, d1euva2
  • Chain 'B':
    Compound: ubitqutin-like protein smt3
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1euvb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1euvA (A:)
    gslvpelnekdddqvqkalasrentqlmnrdnieitvrdfktlaprrwlndtiieffmky
    iekstpntvafnsffytnlsergyqgvrrwmkrkktqidkldkiftpinlnqshwalgii
    dlkkktigyvdslsngpnamsfailtdlqkyvmeeskhtigedfdlihldcpqqpngydc
    giyvcmntlygsadapldfdykdairmrrfiahliltdalk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1euvB (B:)
    evkpevkpethinlkvsdgsseiffkikkttplrrlmeafakrqgkemdslrflydgiri
    qadqtpedldmedndiieahreqigg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1euvB (B:)
    pethinlkvsdgsseiffkikkttplrrlmeafakrqgkemdslrflydgiriqadqtpe
    dldmedndiieahreqigg