PDB entry 1euu

View 1euu on RCSB PDB site
Description: sialidase or neuraminidase, large 68kd form
Deposited on 1996-06-21, released 1997-01-11
The last revision prior to the SCOP 1.69 freeze date was dated 1997-01-11, with a file datestamp of 1997-01-13.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.228
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1euu_ (-)
    vppggeplyteqdlavngregfpnyripaltvtpdgdllasydgrptgidapgpnsilqr
    rstdggrtwgeqqvvsagqttapikgfsdpsylvdretgtifnfhvysqrqgfagsrpgt
    dpadpnvlhanvatstdggltwshrtitaditpdpgwrsrfaasgegiqlrygphagrli
    qqytiinaagafqavsvysddhgrtwrageavgvgmdenktvelsdgrvllnsrdsarsg
    yrkvavstdgghsygpvtidrdlpdptnnasiirafpdapagsarakvllfsnaasqtsr
    sqgtirmscddgqtwpvskvfqpgsmsystltalpdgtygllyepgtgiryanfnlawlg
    gicapftipdvalepgqqvtvpvavtnqsgiavpkpslqldaspdwqvqgsveplmpgrq
    akgqvtitvpagttpgryrvgatlrtsagnasttftvtvglldqarmsiadvdseetare
    dgrasnvidgnpstfwhtewsradapgyphrisldlggthtisglqytrrqnsaneqvad
    yeiytslngttwdgpvasgrfttslapqravfpardaryirlvalseqtghkyaavaele
    vegqr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1euu_ (-)
    geplyteqdlavngregfpnyripaltvtpdgdllasydgrptgidapgpnsilqrrstd
    ggrtwgeqqvvsagqttapikgfsdpsylvdretgtifnfhvysqrqgfagsrpgtdpad
    pnvlhanvatstdggltwshrtitaditpdpgwrsrfaasgegiqlrygphagrliqqyt
    iinaagafqavsvysddhgrtwrageavgvgmdenktvelsdgrvllnsrdsarsgyrkv
    avstdgghsygpvtidrdlpdptnnasiirafpdapagsarakvllfsnaasqtsrsqgt
    irmscddgqtwpvskvfqpgsmsystltalpdgtygllyepgtgiryanfnlawlggica
    pftipdvalepgqqvtvpvavtnqsgiavpkpslqldaspdwqvqgsveplmpgrqakgq
    vtitvpagttpgryrvgatlrtsagnasttftvtvglldqarmsiadvdseetaredgra
    snvidgnpstfwhtewsradapgyphrisldlggthtisglqytrrqnsaneqvadyeiy
    tslngttwdgpvasgrfttslapqravfpardaryirlvalseqtghkyaavaelevegq
    r