PDB entry 1eur

View 1eur on RCSB PDB site
Description: sialidase
Deposited on 1996-06-21, released 1997-01-11
The last revision prior to the SCOP 1.71 freeze date was dated 1997-01-11, with a file datestamp of 1997-01-13.
Experiment type: XRAY
Resolution: 1.82 Å
R-factor: 0.173
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.71: d1eur__

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1eur_ (-)
    vppggeplyteqdlavngregfpnyripaltvtpdgdllasydgrptgidapgpnsilqr
    rstdggrtwgeqqvvsagqttapikgfsdpsylvdretgtifnfhvysqrqgfagsrpgt
    dpadpnvlhanvatstdggltwshrtitaditpdpgwrsrfaasgegiqlrygphagrli
    qqytiinaagafqavsvysddhgrtwrageavgvgmdenktvelsdgrvllnsrdsarsg
    yrkvavstdgghsygpvtidrdlpdptnnasiirafpdapagsarakvllfsnaasqtsr
    sqgtirmscddgqtwpvskvfqpgsmsystltalpdgtygllyepgtgiryanfnlawlg
    gicap
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eur_ (-)
    geplyteqdlavngregfpnyripaltvtpdgdllasydgrptgidapgpnsilqrrstd
    ggrtwgeqqvvsagqttapikgfsdpsylvdretgtifnfhvysqrqgfagsrpgtdpad
    pnvlhanvatstdggltwshrtitaditpdpgwrsrfaasgegiqlrygphagrliqqyt
    iinaagafqavsvysddhgrtwrageavgvgmdenktvelsdgrvllnsrdsarsgyrkv
    avstdgghsygpvtidrdlpdptnnasiirafpdapagsarakvllfsnaasqtsrsqgt
    irmscddgqtwpvskvfqpgsmsystltalpdgtygllyepgtgiryanfnlawlggica
    p