PDB entry 1euq

View 1euq on RCSB PDB site
Description: crystal structure of glutaminyl-trna synthetase complexed with a trna-gln mutant and an active-site inhibitor
Deposited on 2000-04-17, released 2000-06-04
The last revision prior to the SCOP 1.69 freeze date was dated 2000-06-04, with a file datestamp of 2000-06-04.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.242
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1euqA (A:)
    mseaearptnfirqiidedlasgkhttvhtrfppepngylhighaksiclnfgiaqdykg
    qcnlrfddtnpvkedieyvesikndvewlgfhwsgnvryssdyfdqlhayaielinkgla
    yvdeltpeqireyrgtltqpgknspyrdrsveenlalfekmraggfeegkaclrakidma
    spfivmrdpvlyrikfaehhqtgnkwciypmydfthcisdalegithslctlefqdnrrl
    ydwvldnitipvhprqyefsrlnleytvmskrklnllvtdkhvegwddprmptisglrrr
    gytaasirefckrigvtkqdntiemaslesciredlnenapramavidpvklvienyqge
    gemvtmpnhpnkpemgsrqvpfsgeiwidradfreeankqykrlvlgkevrlrnayvika
    ervekdaegnittifctydadtlskdpadgrkvkgvihwvsaahalpveirlydrlfsvp
    npgaaddflsvinpeslvikqgfaepslkdavagkafqferegyfcldsrhstaekpvfn
    rtvglrdt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1euqA (A:)
    tnfirqiidedlasgkhttvhtrfppepngylhighaksiclnfgiaqdykgqcnlrfdd
    tnpvkedieyvesikndvewlgfhwsgnvryssdyfdqlhayaielinkglayvdeltpe
    qireyrgtltqpgknspyrdrsveenlalfekmraggfeegkaclrakidmaspfivmrd
    pvlyrikfaehhqtgnkwciypmydfthcisdalegithslctlefqdnrrlydwvldni
    tipvhprqyefsrlnleytvmskrklnllvtdkhvegwddprmptisglrrrgytaasir
    efckrigvtkqdntiemaslesciredlnenapramavidpvklvienyqgegemvtmpn
    hpnkpemgsrqvpfsgeiwidradfreeankqykrlvlgkevrlrnayvikaervekdae
    gnittifctydadtlgvihwvsaahalpveirlydrlfsvpnpgaaddflsvinpeslvi
    kqgfaepslkdavagkafqferegyfcldsrhstaekpvfnrtvglrdt