PDB entry 1euo

View 1euo on RCSB PDB site
Description: Crystal structure of nitrophorin 2 (prolixin-S)
Class: signaling protein
Keywords: beta barrel, lipocalin, heme, SIGNALING PROTEIN
Deposited on 2000-04-17, released 2000-05-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.195
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nitrophorin 2
    Species: Rhodnius prolixus [TaxId:13249]
    Gene: SALIVARY GLAND CDNA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q26241 (1-179)
      • cloning artifact (0)
    Domains in SCOPe 2.06: d1euoa1, d1euoa2
  • Heterogens: HEM, NH3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1euoA (A:)
    mdcstnispkqgldkakyfsgkwyvthfldkdpqvtdqycssftpresdgtvkealyhyn
    ankktsfynigegklessglqytakyktvdkkkavlkeadeknsytltvleaddssalvh
    iclregskdlgdlytvlthqkdaepsakvksavtqaglqlsqfvgtkdlgcqyddqftsl