PDB entry 1eun

View 1eun on RCSB PDB site
Description: structure of 2-keto-3-deoxy-6-phosphogluconate aldolase from escherichia coli
Class: lyase
Keywords: 2-keto-3-deoxy-6-phosphogluconate aldolase, sulfate, trimer, beta-barrel, LYASE
Deposited on 2000-04-17, released 2001-02-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.202
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: kdpg aldolase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1euna_
  • Chain 'B':
    Compound: kdpg aldolase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1eunb_
  • Chain 'C':
    Compound: kdpg aldolase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1eunc_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eunA (A:)
    mknwktsaesilttgpvvpvivvkklehavpmakalvaggvrvlevtlrtecavdairai
    akevpeaivgagtvlnpqqlaevteagaqfaispgltepllkaategtiplipgistvse
    lmlgmdyglkefkffpaeanggvkalqaiagpfsqvrfcptggispanyrdylalksvlc
    iggswlvpadaleagdydritklareavegakl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eunB (B:)
    mknwktsaesilttgpvvpvivvkklehavpmakalvaggvrvlevtlrtecavdairai
    akevpeaivgagtvlnpqqlaevteagaqfaispgltepllkaategtiplipgistvse
    lmlgmdyglkefkffpaeanggvkalqaiagpfsqvrfcptggispanyrdylalksvlc
    iggswlvpadaleagdydritklareavegakl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eunC (C:)
    mknwktsaesilttgpvvpvivvkklehavpmakalvaggvrvlevtlrtecavdairai
    akevpeaivgagtvlnpqqlaevteagaqfaispgltepllkaategtiplipgistvse
    lmlgmdyglkefkffpaeanggvkalqaiagpfsqvrfcptggispanyrdylalksvlc
    iggswlvpadaleagdydritklareavegakl