PDB entry 1eui

View 1eui on RCSB PDB site
Description: escherichia coli uracil-DNA glycosylase complex with uracil-DNA glycosylase inhibitor protein
Class: complex (hydrolase/inhibitor)
Keywords: glycosylase, inhibitor, DNA repair, base excision, complex (hydrolase/inhibitor)
Deposited on 1998-06-18, released 1999-06-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.205
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: uracil-DNA glycosylase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1euia_
  • Chain 'B':
    Compound: uracil-DNA glycosylase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1euib_
  • Chain 'C':
    Compound: uracil-DNA glycosylase inhibitor protein
    Species: Bacillus phage PBS2 [TaxId:10684]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1euic_
  • Chain 'D':
    Compound: uracil-DNA glycosylase inhibitor protein
    Species: Bacillus phage PBS2 [TaxId:10684]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1euid_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1euiA (A:)
    aneltwhdvlaeekqqpyflntlqtvaserqsgvtiyppqkdvfnafrftelgdvkvvil
    gqdpyhgpgqahglafsvrpgiaippsllnmykelentipgftrpnhgyleswarqgvll
    lntvltvragqahshaslgwetftdkvislinqhregvvfllwgshaqkkgaiidkqrhh
    vlkaphpsplsahrgffgcnhfvlanqwleqrgetpidwmpvlpaese
    

    Sequence, based on observed residues (ATOM records): (download)
    >1euiA (A:)
    twhdvlaeekqqpyflntlqtvaserqsgvtiyppqkdvfnafrftelgdvkvvilgqdp
    yhgpgqahglafsvrpgiaippsllnmykelentipgftrpnhgyleswarqgvlllntv
    ltvragqahshaslgwetftdkvislinqhregvvfllwgshaqkkgaiidkqrhhvlka
    phpsplsahrgffgcnhfvlanqwleqrgetpidwmpvlpa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1euiB (B:)
    aneltwhdvlaeekqqpyflntlqtvaserqsgvtiyppqkdvfnafrftelgdvkvvil
    gqdpyhgpgqahglafsvrpgiaippsllnmykelentipgftrpnhgyleswarqgvll
    lntvltvragqahshaslgwetftdkvislinqhregvvfllwgshaqkkgaiidkqrhh
    vlkaphpsplsahrgffgcnhfvlanqwleqrgetpidwmpvlpaese
    

    Sequence, based on observed residues (ATOM records): (download)
    >1euiB (B:)
    twhdvlaeekqqpyflntlqtvaserqsgvtiyppqkdvfnafrftelgdvkvvilgqdp
    yhgpgqahglafsvrpgiaippsllnmykelentipgftrpnhgyleswarqgvlllntv
    ltvragqahshaslgwetftdkvislinqhregvvfllwgshaqkkgaiidkqrhhvlka
    phpsplsahrgffgcnhfvlanqwleqrgetpidwmpvlp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1euiC (C:)
    mtnlsdiieketgkqlviqesilmlpeeveevignkpesdilvhtaydestdenvmllts
    dapeykpwalviqdsngenkikml
    

    Sequence, based on observed residues (ATOM records): (download)
    >1euiC (C:)
    qlviqesilmlpeeveevignkpesdilvhtaydestdenvmlltsdapeykpwalviqd
    sngenkikml
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1euiD (D:)
    mtnlsdiieketgkqlviqesilmlpeeveevignkpesdilvhtaydestdenvmllts
    dapeykpwalviqdsngenkikml
    

    Sequence, based on observed residues (ATOM records): (download)
    >1euiD (D:)
    qlviqesilmlpeeveevignkpesdilvhtaydestdenvmlltsdapeykpwalviqd
    sngenkikml