PDB entry 1eui

View 1eui on RCSB PDB site
Description:
Deposited on 1998-06-18, released 1999-06-22
The last revision prior to the SCOP 1.55 freeze date was dated 1999-06-22, with a file datestamp of 1999-06-21.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.205
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d1euia_
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d1euib_
  • Chain 'C':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d1euic_
  • Chain 'D':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d1euid_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1euiA (A:)
    twhdvlaeekqqpyflntlqtvaserqsgvtiyppqkdvfnafrftelgdvkvvilgqdp
    yhgpgqahglafsvrpgiaippsllnmykelentipgftrpnhgyleswarqgvlllntv
    ltvragqahshaslgwetftdkvislinqhregvvfllwgshaqkkgaiidkqrhhvlka
    phpsplsahrgffgcnhfvlanqwleqrgetpidwmpvlpa
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1euiB (B:)
    twhdvlaeekqqpyflntlqtvaserqsgvtiyppqkdvfnafrftelgdvkvvilgqdp
    yhgpgqahglafsvrpgiaippsllnmykelentipgftrpnhgyleswarqgvlllntv
    ltvragqahshaslgwetftdkvislinqhregvvfllwgshaqkkgaiidkqrhhvlka
    phpsplsahrgffgcnhfvlanqwleqrgetpidwmpvlp
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1euiC (C:)
    qlviqesilmlpeeveevignkpesdilvhtaydestdenvmlltsdapeykpwalviqd
    sngenkikml
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1euiD (D:)
    qlviqesilmlpeeveevignkpesdilvhtaydestdenvmlltsdapeykpwalviqd
    sngenkikml